Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.15
PubTator Score 6.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 4.4e-05
group 3 medulloblastoma 2254 3.0e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.096 4.4e-05
group 3 medulloblastoma 1.100 3.0e-04

Synonym

Accession Q69YI7 B3KV81 Q8WU12
Symbols C9orf90
bA379C10.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
25725584 MiR-24 acted as an oncomir, at least partially through regulation of its functional target NAIF1 in non-small cell lung cancer.
25432142 NAIF1 plays a role in regulating cellular migration and invasion through the MAPK pathways and may function as a tumor suppressor in the progression of gastric carcinoma.
21286669 NAIF1 is down-regulated in gastric cancer.
18339812 The functions of two transposon-derived human proteins: HARBI1, a domesticated transposase-derived protein, and NAIF1, which contains a trihelix motif similar to that described in the Myb-like protein, was investigated.
16378748 NAIF1 (C9orf90)is a nuclear protein that induces apoptosis when overexpressed

AA Sequence

MAVPAKKRKMNFSEREVEIIVEELELKKHLLVNHFNAGVPLAAKSAAWHGILRRVNAVATCRRELPEVKK      1 - 70
KWSDLKTEVRRKVAQVRAAVEGGEAPGPTEEDGAGGPGTGGGSGGGGPAVAPVLLTPMQQRICNLLGEAT     71 - 140
IISLPSTTEIHPVALGPSATAAAATVTLTQIPTETTYHTLEEGVVEYCTAEAPPPLPPETPVDMMAQHAD    141 - 210
TSVKPQALKSRIALNSAKLIQEQRVTNLHVKEIAQHLEQQNDLLQMIRRSQEVQACAQERQAQAMEGTQA    211 - 280
ALSVLIQVLRPMIKDFRRYLQSNTANPAPASDPGQVAQNGQPDSIIQ                           281 - 327
//

Text Mined References (14)

PMID Year Title
25725584 2015 Upregulation of miR-24 promotes cell proliferation by targeting NAIF1 in non-small cell lung cancer.
25432142 2015 NAIF1 inhibits gastric cancer cells migration and invasion via the MAPK pathways.
25416956 2014 A proteome-scale map of the human interactome network.
21286669 2011 NAIF1 is down-regulated in gastric cancer and promotes apoptosis through the caspase-9 pathway in human MKN45 cells.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
18339812 2008 Transposition of a reconstructed Harbinger element in human cells and functional homology with two transposon-derived cellular genes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16378748 2006 Overexpression of the novel human gene, nuclear apoptosis-inducing factor 1, induces apoptosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
203245 1977 [The morphological effect of conjugated estrogens on the ovaries of old white rats and the selective Lipschutz phenomenon (proceedings)].