Property Summary

NCBI Gene PubMed Count 26
PubMed Score 21.08
PubTator Score 20.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.158 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.300 3.4e-02
lung cancer 1.700 9.3e-03
sonic hedgehog group medulloblastoma 1.100 2.4e-04
ovarian cancer -1.800 1.2e-04

Protein-protein Interaction (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
651699 screening 2123 / 0 / 362045 uHTS identification of inhibitors of cullin neddylation in a TR-FRET assay
651722 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of cullin neddylation
652217 screening 235 / 0 / 1597 Single concentration confirmation of inhibitors of cullin neddylation in a TR-FRET assay
652247 confirmatory 27 / 0 / 177 Dose-response confirmation of inhibitors of cullin neddylation in a TR-FRET assay

Gene RIF (10)

PMID Text
26215564 HIV-1 Vpu depends on NAE1-mediated neddylation (covalent addition of NEDD8 protein onto cullin backbone lysine residue rendering the cullin-RING E3 ubiquitin ligase complex catalytically active) to downregulate CD4
25229838 E1 (NAE1 and UBA3) and E2 (UBC12) enzymes, as well as global NEDD8 conjugation, were upregulated in over 2/3 of human intrahepatic cholangiocarcinoma
23185368 analysis of a metal-based inhibitor of NEDD8-activating enzyme
22182960 our results suggest that APP-BP1 modulates neuronal differentiation by altering gene expression profiles in fetal neural stem cells
21151996 APP-BP1 plays an important role in the cell cycle progression of fetal neural stem cells
19795456 APP-BP1 displayed decreased expression levels in HPV-positive head and neck squamous cell carcinoma
18627766 APP-BP1 is degraded by ubiquitin-dependent proteolysis.
14690597 Data report the structure of the quaternary complex between human APPBP1-UBA3, a heterodimeric E1, its ubl NEDD8, and ATP.
12740388 Conservation in the mechanism of Nedd8 activation by the human AppBp1-Uba3 heterodimer.
12646924 structure and mutational analysis of human APPBP1-UBA3, the heterodimeric E1 enzyme for NEDD8

AA Sequence

MAQLGKLLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDA      1 - 70
GNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLA     71 - 140
DVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHS    141 - 210
HTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQ    211 - 280
IPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKA    281 - 350
KKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPD    351 - 420
NEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEP    421 - 490
HTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL                              491 - 534
//

Text Mined References (30)

PMID Year Title
25229838 2014 Neddylation pathway is up-regulated in human intrahepatic cholangiocarcinoma and serves as a potential therapeutic target.
23185368 2012 A metal-based inhibitor of NEDD8-activating enzyme.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22182960 2012 Amyloid precursor protein binding protein-1 knockdown reduces neuronal differentiation in fetal neural stem cells.
21269460 2011 Initial characterization of the human central proteome.
21151996 2010 Amyloid precursor protein binding protein-1 modulates cell cycle progression in fetal neural stem cells.
19795456 2010 Biological and clinical relevance of transcriptionally active human papillomavirus (HPV) infection in oropharynx squamous cell carcinoma.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18627766 2008 TRIP12 functions as an E3 ubiquitin ligase of APP-BP1.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16620772 2006 A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers.
16503656 2006 Analysis of Nedd8-associated polypeptides: a model for deciphering the pathway for ubiquitin-like modifications.
16400609 2006 Single-nucleotide polymorphisms in NAGNAG acceptors are highly predictive for variations of alternative splicing.
16341674 2005 Transcriptome analysis of human gastric cancer.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361859 2004 A unique E1-E2 interaction required for optimal conjugation of the ubiquitin-like protein NEDD8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14690597 2003 The structure of the APPBP1-UBA3-NEDD8-ATP complex reveals the basis for selective ubiquitin-like protein activation by an E1.
14557245 2003 APP-BP1 mediates APP-induced apoptosis and DNA synthesis and is increased in Alzheimer's disease brain.
12740388 2003 Conservation in the mechanism of Nedd8 activation by the human AppBp1-Uba3 heterodimer.
12694406 2003 ASPP2 inhibits APP-BP1-mediated NEDD8 conjugation to cullin-1 and decreases APP-BP1-induced cell proliferation and neuronal apoptosis.
12646924 2003 Insights into the ubiquitin transfer cascade from the structure of the activating enzyme for NEDD8.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10722740 2000 The amyloid precursor protein-binding protein APP-BP1 drives the cell cycle through the S-M checkpoint and causes apoptosis in neurons.
10597293 1999 Covalent modification of all members of human cullin family proteins by NEDD8.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
10207026 1999 Identification of the activating and conjugating enzymes of the NEDD8 conjugation pathway.
8626687 1996 APP-BP1, a novel protein that binds to the carboxyl-terminal region of the amyloid precursor protein.