Property Summary

NCBI Gene PubMed Count 22
PubMed Score 30.36
PubTator Score 50.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.135 2.5e-02
Multiple myeloma 1.196 1.9e-03
cutaneous lupus erythematosus 1.900 2.7e-03
psoriasis -1.800 5.5e-05
osteosarcoma -3.275 2.3e-10
astrocytoma 1.200 6.4e-03
atypical teratoid / rhabdoid tumor 1.400 6.2e-08
glioblastoma 1.500 5.6e-05
medulloblastoma, large-cell 1.600 8.8e-05
tuberculosis 1.300 6.1e-06
pediatric high grade glioma 1.200 5.3e-05
COPD -1.200 1.2e-03
ovarian cancer 2.700 1.1e-05
axial spondyloarthropathy 1.100 3.6e-02

Protein-protein Interaction (1)

Gene RIF (5)

PMID Text
26806015 Depletion of wild-type NADK in pancreatic ductal adenocarcinoma cells attenuates cancer cell growth.
26577408 Taken together, this indicates that Ser-188 (and perhaps the other residues) is an important phosphorylation site that can downregulate the NAD kinase activity of this critical enzyme.
21526340 Using purified human NAD kinase, we revealed a sigmoidal kinetic behavior toward ATP and the inhibitory effects of NADPH and NADH
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17855339 NAD kinase levels control the NADPH concentration in human cells

AA Sequence

MEMEQEKMTMNKELSPDAAAYCCSACHGDETWSYNHPIRGRAKSRSLSASPALGSTKEFRRTRSLHGPCP      1 - 70
VTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVLVIKKMRDASLLQPFKELCTHLMEENMIVYVEK     71 - 140
KVLEDPAIASDESFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLG    141 - 210
FLTPFSFENFQSQVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGENGSQAAGLDMDVGKQAMQY    211 - 280
QVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICP    281 - 350
HSLSFRPIVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFES    351 - 420
LAQCLHWNVRKKQAHFEEEEEEEEEG                                                421 - 446
//

Text Mined References (27)

PMID Year Title
26806015 2016 Functional annotation of rare gene aberration drivers of pancreatic cancer.
26577408 2015 Significance of Ser-188 in human mitochondrial NAD kinase as determined by phosphomimetic and phosphoresistant amino-acid substitutions.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21526340 2011 NADPH regulates human NAD kinase, a NADP?-biosynthetic enzyme.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17855339 2007 NAD kinase levels control the NADPH concentration in human cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14704851 2004 Enzymology of NAD+ homeostasis in man.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11594753 2001 Structural and functional characterization of human NAD kinase.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.