Property Summary

NCBI Gene PubMed Count 7
PubMed Score 86.92
PubTator Score 19.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.233 4.0e-07
astrocytoma 2.000 1.2e-02
Astrocytoma, Pilocytic 1.100 1.3e-05
atypical teratoid / rhabdoid tumor -1.100 4.7e-03
dermatomyositis 1.700 2.0e-04
gastric carcinoma 1.100 2.8e-02
group 3 medulloblastoma -3.500 1.6e-08
invasive ductal carcinoma -1.700 6.9e-03
medulloblastoma, large-cell -4.900 1.6e-05
non primary Sjogren syndrome sicca 1.400 1.4e-02
non-small cell lung cancer -1.093 1.8e-11
osteosarcoma -1.904 9.5e-04
ovarian cancer -2.100 1.1e-04
primitive neuroectodermal tumor -1.300 3.6e-02
psoriasis -1.300 1.0e-07
tuberculosis 2.300 5.0e-06

Gene RIF (3)

AA Sequence

MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELP      1 - 70
GSVPPACFQQILSFCYTGRLTMTASEQLVVMYTAGFLQIQHIVERGTDLMFKVSSPHCDSQTAVIEDAGS     71 - 140
EPQSPCNQLQPAAAAAAPYVVSPSVPIPLLTRVKHEAMELPPAGPGLAPKRPLETGPRDGVAVAAGAAVA    141 - 210
AGTAPLKLPRVSYYGVPSLATLIPGIQQMPYPQGERTSPGASSLPTTDSPTSYHNEEDEEDDEAYDTMVE    211 - 280
EQYGQMYIKASGSYAVQEKPEPVPLESRSCVLIRRDLVALPASLISQIGYRCHPKLYSEGDPGEKLELVA    281 - 350
GSGVYITRGQLMNCHLCAGVKHKVLLRRLLATFFDRNTLANSCGTGIRSSTSDPSRKPLDSRVLNAVKLY    351 - 420
CQNFAPSFKESEMNVIAADMCTNARRVRKRWLPKIKSMLPEGVEMYRTVMGSAAASVPLDPEFPPAAAQV    421 - 490
FEQRIYAERRGDAATIVALRTDAVNVDLSAAANPAFDAGEEVDGAGSVIQEVAAPEPLPADGQSPPQPFE    491 - 560
QGGGGPSRPQTPAAAARRPEGTYAGTL                                               561 - 587
//

Text Mined References (9)

PMID Year Title