Property Summary

NCBI Gene PubMed Count 38
PubMed Score 22.56
PubTator Score 136.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Skeletal muscle neoplasm 8 4.53 2.3

Gene RIF (12)

PMID Text
25209525 Low NACA expression is associated with rhabdomyosarcoma.
24901053 depletion of alphaNAC in multiple types of cancer cells induce typical apoptotic cell death. This anti-apoptotic function is mediated by the FADD/c-Jun N-terminal kinase pathway.
22082360 [review] First evidence of a functional interaction between ATF4, FIAT (factor-inhibiting ATF4-mediated transcription) and alphaNAC (nascent polypeptide-associated complex and coactivator alpha).
21509594 NACA gene expression is decreased in both classic and follicular variants of papillary thyroid carcinoma.
20214399 identified a region in the NAC domain of the human NAC alpha-subunit as a new nucleic acid-binding region, which is blocked from binding nucleic acids in the heterodimeric complex by a helix region in the beta-subunit
19609276 Alpha NAC downregulation in hypoxic cells or NAC ablation by NAC short-interfering RNA (siRNA) leads to the initiation of ER stress responses, which results in caspase-dependent apoptosis.
17676665 HIV-1 gp120 downregulates the expression of nascent polypeptide-associated complex alpha subunit in T-cell lines
15784678 Altogether, these results characterize NACA as a new factor involved in the positive regulation of human erythroid-cell differentiation.
12699894 virtual Northern blots to analyze expression of NACA and ANX2 in progenitor cultures of nine children with Juvenile myelomonocytic leukemia and five healthy individuals
12406326 a novel isoform of alpha-nascent polypeptide-associated complex as IgE-defined autoantigen
12109594 Human brain nascent polypeptide-associated complex alpha subunit is decreased in patients with Alzheimer' s disease and Down syndrome.
8698236 A 220 kDa isoform of Naca is expressed in mouse muscle tissues

AA Sequence

MPGEATETVPATEQELPQPQAETGSGTESDSDESVPELEEQDSTQATTQQAQLAAAAEIDEEPVSKAKQS      1 - 70
RSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAA     71 - 140
EKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNSNDIVNAI    141 - 210
MELTM                                                                     211 - 215
//

Text Mined References (52)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25209525 2014 Overexpression of the skNAC gene in human rhabdomyosarcoma cells enhances their differentiation potential and inhibits tumor cell growth and spreading.
24901053 2014 ?NAC inhibition of the FADD-JNK axis plays anti-apoptotic role in multiple cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22082360 2011 Combinatorial control of ATF4-dependent gene transcription in osteoblasts.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21203952 2010 Crystal structures of NAC domains of human nascent polypeptide-associated complex (NAC) and its ?NAC subunit.
21071677 2010 skNAC, a Smyd1-interacting transcription factor, is involved in cardiac development and skeletal muscle growth and regeneration.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20214399 2010 The crystal structure of the human nascent polypeptide-associated complex domain reveals a nucleic acid-binding region on the NACA subunit .
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19609276 2009 alphaNAC depletion as an initiator of ER stress-induced apoptosis in hypoxia.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19211926 2009 skNAC (skeletal Naca), a muscle-specific isoform of Naca (nascent polypeptide-associated complex alpha), is required for myofibril organization.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16541075 2006 The finished DNA sequence of human chromosome 12.
16201836 2005 Emergence of young human genes after a burst of retroposition in primates.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15784678 2005 NACA is a positive regulator of human erythroid-cell differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15299025 2004 Integrin-linked kinase regulates the nuclear entry of the c-Jun coactivator alpha-NAC and its coactivation potency.
15196207 2004 Investigation of alpha nascent polypeptide-associated complex functions in a human CD8(+) T cell ex vivo expansion model using antisense oligonucleotides.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12699894 2003 Expression analysis of alpha-NAC and ANX2 in juvenile myelomonocytic leukemia using SMART polymerase chain reaction and "virtual Northern" hybridization.
12689679 2003 Activation of the JNK-AP-1 signal transduction pathway is associated with pathogenesis and progression of human osteosarcomas.
12684039 2003 The alpha-chain of the nascent polypeptide-associated complex binds to and regulates FADD function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406326 2002 Characterization of a novel isoform of alpha-nascent polypeptide-associated complex as IgE-defined autoantigen.
12209604 2002 Novel products of the HUD, HUC, NNP-1 and alpha-internexin genes identified by autologous antibody screening of a pediatric neuroblastoma library.
12011100 2002 m-Bop, a repressor protein essential for cardiogenesis, interacts with skNAC, a heart- and muscle-specific transcription factor.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10982809 2000 The alpha and beta subunit of the nascent polypeptide-associated complex have distinct functions.
10224091 1999 Cloning of novel injury-regulated genes. Implications for an important role of the muscle-specific protein skNAC in muscle repair.
9877153 1998 Unregulated exposure of the ribosomal M-site caused by NAC depletion results in delivery of non-secretory polypeptides to the Sec61 complex.
9806765 1998 Isolation of cDNA clones coding for IgE autoantigens with serum IgE from atopic dermatitis patients.
9488446 1998 Bone-specific expression of the alpha chain of the nascent polypeptide-associated complex, a coactivator potentiating c-Jun-mediated transcription.
9488445 1998 The alpha chain of the nascent polypeptide-associated complex functions as a transcriptional coactivator.
8835540 1996 Mapping of the human gene for the alpha-NAC/1.9.2 (NACA/1.9.2) transcriptional coactivator to Chromosome 12q23-24.1.
8698236 1996 Differential splicing-in of a proline-rich exon converts alphaNAC into a muscle-specific transcription factor.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8047162 1994 A protein complex required for signal-sequence-specific sorting and translocation.