Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.96
PubTator Score 20.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.6e-05
glioblastoma 1.200 3.5e-05
medulloblastoma, large-cell 1.300 9.6e-04

Gene RIF (8)

AA Sequence

MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRL      1 - 70
TKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGP     71 - 140
SAASPASENQNGNGLSAPPGPGGGPHPPHTPSHPPSTRITRSQPNHTPAGPPGPSSNPVSNGKETRRSSK    141 - 210
R//

Text Mined References (18)

PMID Year Title