Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.38
PubTator Score 3.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
hepatocellular carcinoma 1.400 4.5e-04
malignant mesothelioma -2.800 3.1e-07
osteosarcoma -1.615 7.5e-03
juvenile dermatomyositis 1.057 1.0e-05
acute quadriplegic myopathy 1.065 1.3e-04
Atopic dermatitis 1.500 8.1e-04
tuberculosis and treatment for 6 months -2.300 3.2e-05
intraductal papillary-mucinous neoplasm ... 1.800 3.7e-02
lung cancer -4.000 5.2e-07
Breast cancer 3.600 4.4e-02
interstitial cystitis 1.300 1.0e-02
cystic fibrosis 1.100 1.4e-02
group 4 medulloblastoma -1.300 3.6e-05
primary Sjogren syndrome 1.800 1.4e-03
psoriasis 1.600 1.4e-59
subependymal giant cell astrocytoma 1.579 3.5e-02
lung carcinoma -3.300 6.3e-31
gastric carcinoma 1.700 1.9e-02
ulcerative colitis 1.300 3.4e-04
ovarian cancer 3.000 4.5e-05
pituitary cancer -1.300 3.7e-03

Synonym

Accession Q96AH0 Q658Y8 Q9H5X6
Symbols SSB2
OBFC2A
SOSS-B2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
19605351 hSSB1 and hSSB2 form two separate complexes with similar structures, and both complexes participate in DNA damage response.

AA Sequence

MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGD      1 - 70
IIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNM     71 - 140
GTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR          141 - 204
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23266556 2013 Identification of Genetic Susceptibility Loci for Colorectal Tumors in a Genome-Wide Meta-analysis.
19683501 2009 SOSS complexes participate in the maintenance of genomic stability.
19605351 2009 HSSB1 and hSSB2 form similar multiprotein complexes that participate in DNA damage response.
18449195 2008 Single-stranded DNA-binding protein hSSB1 is critical for genomic stability.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.