Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.40
PubTator Score 3.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.172 1.6e-02
interstitial cystitis -2.000 1.8e-03
lung adenocarcinoma 1.300 4.4e-11
pilocytic astrocytoma 1.100 1.9e-04
Breast cancer -1.600 4.2e-07
ovarian cancer -1.700 1.1e-04

Gene RIF (3)

PMID Text
24240687 Data suggest that changes in expression of N-acetyl-L-aspartyl-L-glutamate peptidase-like 2 (NAALADL2) can impact upon a number of pro-oncogenic pathways and processes, making it a useful biomarker for both diagnosis and prognosis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19132087 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MGENEASLPNTSLQGKKMAYQKVHADQRAPGHSQYLDNDDLQATALDLEWDMEKELEESGFDQFQLDGAE      1 - 70
NQNLGHSETIDLNLDSIQPATSPKGRFQRLQEESDYITHYTRSAPKSNRCNFCHVLKILCTATILFIFGI     71 - 140
LIGYYVHTNCPSDAPSSGTVDPQLYQEILKTIQAEDIKKSFRNLVQLYKNEDDMEISKKIKTQWTSLGLE    141 - 210
DVQFVNYSVLLDLPGPSPSTVTLSSSGQCFHPNGQPCSEEARKDSSQDLLYSYAAYSAKGTLKAEVIDVS    211 - 280
YGMADDLKRIRKIKNVTNQIALLKLGKLPLLYKLSSLEKAGFGGVLLYIDPCDLPKTVNPSHDTFMVSLN    281 - 350
PGGDPSTPGYPSVDESFRQSRSNLTSLLVQPISAPLVAKLISSPKARTKNEACSSLELPNNEIRVVSMQV    351 - 420
QTVTKLKTVTNVVGFVMGLTSPDRYIIVGSHHHTAHSYNGQEWASSTAIITAFIRALMSKVKRGWRPDRT    421 - 490
IVFCSWGGTAFGNIGSYEWGEDFKKVLQKNVVAYISLHSPIRGNSSLYPVASPSLQQLVVEKNNFNCTRR    491 - 560
AQCPETNISSIQIQGDADYFINHLGVPIVQFAYEDIKTLEGPSFLSEARFSTRATKIEEMDPSFNLHETI    561 - 630
TKLSGEVILQIANEPVLPFNALDIALEVQNNLKGDQPNTHQLLAMALRLRESAELFQSDEMRPANDPKER    631 - 700
APIRIRMLNDILQDMEKSFLVKQAPPGFYRNILYHLDEKTSRFSILIEAWEHCKPLASNETLQEALSEVL    701 - 770
NSINSAQVYFKAGLDVFKSVLDGKN                                                 771 - 795
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24240687 2014 N-acetyl-L-aspartyl-L-glutamate peptidase-like 2 is overexpressed in cancer and promotes a pro-migratory and pro-metastatic phenotype.
23728906 2013 A genome-wide association study of sleep habits and insomnia.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23456168 2013 Genome-wide association study in Han Chinese identifies three novel loci for human height.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21408207 2011 Differential genetic associations for systemic lupus erythematosus based on anti-dsDNA autoantibody production.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19132087 2009 A genome-wide association study identifies novel and functionally related susceptibility Loci for Kawasaki disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15168106 2004 A giant novel gene undergoing extensive alternative splicing is severed by a Cornelia de Lange-associated translocation breakpoint at 3q26.3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.