Property Summary

NCBI Gene PubMed Count 9
PubMed Score 30.41
PubTator Score 2.06

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 1.16355175387179E-7
ovarian cancer 8492 4.2556962795723E-7
lung cancer 4473 4.74045733897141E-4
ductal carcinoma in situ 1745 0.00141525101327332
psoriasis 6685 0.00363002400409201
interstitial cystitis 2299 0.004885725401924
invasive ductal carcinoma 2950 0.00532541440192118
aldosterone-producing adenoma 664 0.00665585408940037
medulloblastoma, large-cell 6234 0.00932050919031334
atypical teratoid / rhabdoid tumor 4369 0.0129334803777158
pituitary cancer 1972 0.0284788297364763
pilocytic astrocytoma 3086 0.0332107357108924
osteosarcoma 7933 0.0353420093018037
posterior fossa group B ependymoma 1530 0.0398872664421486
medulloblastoma 1524 0.049138788574168


  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
psoriasis -1.500 0.004
osteosarcoma -1.586 0.035
atypical teratoid / rhabdoid tumor -1.600 0.013
medulloblastoma -1.300 0.049
medulloblastoma, large-cell -1.600 0.009
lung cancer -1.400 0.000
interstitial cystitis -1.400 0.005
pilocytic astrocytoma 1.200 0.033
posterior fossa group B ependymoma 1.100 0.040
aldosterone-producing adenoma -1.580 0.007
ductal carcinoma in situ -2.500 0.001
invasive ductal carcinoma -2.800 0.005
ovarian cancer -1.100 0.000
pituitary cancer -1.100 0.028


Accession Q9Y3Q0 B3KQR4 Q4KKV4 Q4VAM9
Symbols GCPIII


PANTHER Protein Class (1)


3FEC   3FED   3FEE   3FF3  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae OMA EggNOG

 GWAS Trait (1)

Gene RIF (3)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12204797 GCPII polymorphism may affect the predisposition to cardiovascular diseases.
11905994 four novel compounds, Ac-Glu-Met, Ac-Asp-Met and, surprisingly, Ac-Ala-Glu and Ac-Ala-Met were identified as substrates for GCPII

AA Sequence

AIFDIENKANSRLAWKEVKKHISIAAFTIQAAAGTLKEVL                                  701 - 740

Text Mined References (11)

PMID Year Title
21738478 2011 Identification of nine novel loci associated with white blood cell subtypes in a Japanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19678840 2009 Structural insight into the evolutionary and pharmacologic homology of glutamate carboxypeptidases II and III.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12204797 2002 Influence of a glutamate carboxypeptidase II (GCPII) polymorphism (1561C-->T) on plasma homocysteine, folate and vitamin B(12) levels and its relationship to cardiovascular disease risk.
11352574 2001 Identification of genes from a schizophrenia-linked translocation breakpoint region.