Property Summary

Ligand Count 34
NCBI Gene PubMed Count 18
PubMed Score 463.38
PubTator Score 52.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia 1.200 2.2e-02
colon cancer -2.300 1.3e-03
interstitial cystitis 1.300 2.8e-03
lung cancer -1.700 3.2e-04
lung carcinoma 1.600 2.0e-21
malignant mesothelioma -1.300 1.9e-06
non primary Sjogren syndrome sicca 1.200 1.7e-02
osteosarcoma -1.324 9.7e-03
ovarian cancer -1.500 1.2e-05
pancreatic ductal adenocarcinoma liver m... -1.474 5.4e-04
tuberculosis 1.700 1.2e-07
ulcerative colitis -2.000 1.2e-08

Gene RIF (8)

AA Sequence

MRTADREARPGLPSLLLLLLAGAGLSAASPPAAPRFNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGD      1 - 70
RVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCDFMNLSLADCLLVNLAYESSVFCTSIVAQDSRGHIYH     71 - 140
GRNLDYPFGNVLRKLTVDVQFLKNGQIAFTGTTFIGYVGLWTGQSPHKFTVSGDERDKGWWWENAIAALF    141 - 210
RRHIPVSWLIRATLSESENFEAAVGKLAKTPLIADVYYIVGGTSPREGVVITRNRDGPADIWPLDPLNGA    211 - 280
WFRVETNYDHWKPAPKEDDRRTSAIKALNATGQANLSLEALFQILSVVPVYNNFTIYTTVMSAGSPDKYM    281 - 350
TRIRNPSRK                                                                 351 - 359
//

Text Mined References (19)

PMID Year Title