Property Summary

NCBI Gene PubMed Count 17
PubMed Score 174.69
PubTator Score 222.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.300 1.6e-03
hepatocellular carcinoma 1.600 2.0e-05
pancreatic cancer 1.100 1.0e-03
Multiple myeloma 1.391 5.3e-03
malignant mesothelioma 2.500 1.1e-06
osteosarcoma 1.243 1.4e-02
atypical teratoid / rhabdoid tumor -1.700 1.5e-03
glioblastoma -1.500 6.8e-04
medulloblastoma -1.600 7.3e-05
medulloblastoma, large-cell -2.600 3.8e-05
hereditary spastic paraplegia -1.388 1.2e-02
Atopic dermatitis 1.100 6.8e-04
tuberculosis and treatment for 6 months -2.200 1.2e-04
non-small cell lung cancer 1.441 4.2e-13
intraductal papillary-mucinous neoplasm ... 1.400 1.6e-02
lung cancer 1.300 1.4e-02
Breast cancer 2.400 2.7e-02
cystic fibrosis -1.100 1.8e-03
adult high grade glioma -1.100 1.3e-02
pancreatic carcinoma 1.100 1.0e-03
ovarian cancer 1.700 3.3e-05

Synonym

Accession Q9GZZ1 D3DN74 Q68DQ1
Symbols SAN
MAK3
NAT5
NAT13
NAT5P
NAT13P

Gene

PANTHER Protein Class (2)

PDB

3TFY   2OB0   2PSW   4X5K  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
25886145 The study quantitatively compared the Nt-acetylomes of wild-type yeast S. cerevisiae expressing the endogenous yeast Naa50 (yNaa50), the congenic strain lacking yNaa50, and an otherwise identical strain expressing human Naa50 (hNaa50).
23557624 Development of the first N-terminal acetyltransferase (NAT) inhibitors, including a specific Naa50 inhibitor.
22311970 Human protein N-terminal acetyltransferase hNaa50p (hNAT5/hSAN) follows ordered sequential catalytic mechanism: combined kinetic and NMR study.
21900231 Naa50p can accommodate only an alpha-amino substrate and not a side chain lysine substrate that is acetylated by lysine acetyltransferase enzymes such as Gcn5.
19744929 Nat5 displays both protein N alpha- and N epsilon-acetyltransferase activity.
19398576 Data show that with MAK3 knockdown, p53 is stabilized and phosphorylated and there is a significant transcriptional activation of proapoptotic genes downstream of p53, and that localization of Arl8b is altered, suggesting that Arl8b is a Mak3 substrate.
17502424 May be specifically required for the maintenance of centromeric cohesion in mitosis.
16507339 The first description of the human homologue of Nat5p/San, hNAT5, the third component of the human NatA N-alpha-acetyltransferase complex

AA Sequence

MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQK      1 - 70
RLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYK     71 - 140
RIEPADAHVLQKNLKVPSGQNADVQKTDN                                             141 - 169
//

Text Mined References (25)

PMID Year Title
25886145 2015 N-terminal acetylome analysis reveals the specificity of Naa50 (Nat5) and suggests a kinetic competition between N-terminal acetyltransferases and methionine aminopeptidases.
25416956 2014 A proteome-scale map of the human interactome network.
23557624 2013 Design, synthesis, and kinetic characterization of protein N-terminal acetyltransferase inhibitors.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22311970 2012 Human protein N-terminal acetyltransferase hNaa50p (hNAT5/hSAN) follows ordered sequential catalytic mechanism: combined kinetic and NMR study.
21900231 2011 Structure of a ternary Naa50p (NAT5/SAN) N-terminal acetyltransferase complex reveals the molecular basis for substrate-specific acetylation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19744929 2009 Human Naa50p (Nat5/San) displays both protein N alpha- and N epsilon-acetyltransferase activity.
19660095 2009 A synopsis of eukaryotic Nalpha-terminal acetyltransferases: nomenclature, subunits and substrates.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19398576 2009 Knockdown of human N alpha-terminal acetyltransferase complex C leads to p53-dependent apoptosis and aberrant human Arl8b localization.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17502424 2007 The acetyltransferase activity of San stabilizes the mitotic cohesin at the centromeres in a shugoshin-independent manner.
16507339 2006 Cloning and characterization of hNAT5/hSAN: an evolutionarily conserved component of the NatA protein N-alpha-acetyltransferase complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.