Property Summary

NCBI Gene PubMed Count 21
PubMed Score 179.62
PubTator Score 222.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.100 1.3e-02
Atopic dermatitis 1.100 6.8e-04
atypical teratoid / rhabdoid tumor -1.700 1.5e-03
Breast cancer 2.400 2.7e-02
cystic fibrosis -1.100 1.8e-03
gastric cancer 1.300 1.6e-03
glioblastoma -1.500 6.8e-04
group 4 medulloblastoma -1.200 1.3e-02
hepatocellular carcinoma 1.600 2.0e-05
hereditary spastic paraplegia -1.388 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.400 1.6e-02
lung cancer 1.300 1.4e-02
malignant mesothelioma 2.500 1.1e-06
medulloblastoma, large-cell -2.600 3.8e-05
Multiple myeloma 1.391 5.3e-03
non-small cell lung cancer 1.441 4.2e-13
osteosarcoma 1.243 1.4e-02
ovarian cancer 1.700 3.3e-05
pancreatic cancer 1.100 1.0e-03
pancreatic carcinoma 1.100 1.0e-03
tuberculosis -1.700 5.2e-04

Gene RIF (10)

AA Sequence

MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQK      1 - 70
RLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYK     71 - 140
RIEPADAHVLQKNLKVPSGQNADVQKTDN                                             141 - 169
//

Text Mined References (29)

PMID Year Title