Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.36
PubTator Score 4.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 1.2e-05
dermatomyositis 1.200 1.1e-03
glioblastoma 1.100 3.0e-04
group 3 medulloblastoma 1.200 3.8e-02
lung cancer 1.100 1.5e-03
medulloblastoma, large-cell 1.700 1.4e-05
ovarian cancer -1.200 9.2e-06
Pick disease -1.400 2.3e-05
primitive neuroectodermal tumor 1.800 2.6e-07
progressive supranuclear palsy -1.200 2.1e-02
Rheumatoid arthritis 1.300 7.2e-04

Synonym

Accession Q6N069 B0QZ59 Q5VSP9 Q6P2D5 Q8N5J3 Q8N870
Symbols NARG1L

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MPNVLLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEAYEFVR      1 - 70
KGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQIQMRDLEGYRETRYQL     71 - 140
LQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQTQQVPPNKIDYEYSELILYQNQVMREADLLQESL    141 - 210
EHIEMYEKQICDKLLVEEIKGEILLKLGRLKEASEVFKNLIDRNAENWCYYEGLEKALQISTLEERLQIY    211 - 280
EEISKQHPKAITPRRLPLTLVPGERFRELMDKFLRVNFSKGCPPLFTTLKSLYYNTEKVSIIQELVTNYE    281 - 350
ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAAIASTPTLIELFYMKAKIYKH    351 - 420
IGNLKEAAKWMDEAQSLDTADRFINSKCAKYMLRANMIKEAEEMCSKFTREGTSAMENLNEMQCMWFQTE    421 - 490
CISAYQRLGRYGDALKKCHEVERHFFEITDDQFDFHTYCMRKMTLRAYVDLLRLEDILRRHAFYFKAARS    491 - 560
AIEIYLKLYDNPLTNESKQQEINSENLSAKELKKMLSKQRRAQKKAKLEEERKHAERERQQKNQKKKRDE    561 - 630
EEEEASGLKEELIPEKLERVENPLEEAVKFLIPLKNLVADNIDTHLLAFEIYFRKGKFLLMLQSVKRAFA    631 - 700
INSNNPWLHECLIRFSKSVSNHSNLPDIVSKVLSQEMQKIFVKKDLESFNEDFLKRNATSLQHLLSGAKM    701 - 770
MYFLDKSRQEKAIAIATRLDETIKDKDVKTLIKVSEALLDGSFGNCSSQYEEYRMACHNLLPFTSAFLPA    771 - 840
VNEVDNPNVALNHTANYDVLANEI                                                  841 - 864
//

Text Mined References (14)

PMID Year Title