Property Summary

NCBI Gene PubMed Count 30
PubMed Score 118.03
PubTator Score 106.35

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia 1.500 4.4e-02
astrocytic glioma -1.700 3.5e-02
Atopic dermatitis 1.400 2.6e-03
limb girdle muscular dystrophy 2A -1.043 6.6e-03
oligodendroglioma -1.700 4.4e-02
osteosarcoma 2.058 1.0e-05
ovarian cancer 2.100 5.1e-06
psoriasis 1.200 3.9e-04
Rheumatoid arthritis 2.200 3.0e-03
ulcerative colitis 1.200 2.2e-06

Gene RIF (10)

AA Sequence

MPAVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEAYELVR      1 - 70
RGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRYQL     71 - 140
LQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSELLLYQNQVLREAGLYREAL    141 - 210
EHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIY    211 - 280
EEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEELVVGYE    281 - 350
TSLKSCRLFNPNDDGKEEPPTTLLWVQYYLAQHYDKIGQPSIALEYINTAIESTPTLIELFLVKAKIYKH    351 - 420
AGNIKEAARWMDEAQALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLNEMQCMWFQTE    421 - 490
CAQAYKAMNKFGEALKKCHEIERHFIEITDDQFDFHTYCMRKITLRSYVDLLKLEDVLRQHPFYFKAARI    491 - 560
AIEIYLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQRRAQKKAQIEEEKKNAEKEKQQRNQKKKKDD    561 - 630
DDEEIGGPKEELIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFA    631 - 700
IDSSHPWLHECMIRLFNTAVCESKDLSDTVRTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAK    701 - 770
MVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYRANCHKLFPYALAFMP    771 - 840
PGYEEDMKITVNGDSSAEAEELANEI                                                841 - 866
//

Text Mined References (39)

PMID Year Title