Property Summary

NCBI Gene PubMed Count 72
PubMed Score 236.18
PubTator Score 160.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.295 4.7e-04
colon cancer 1.100 2.6e-02
lung cancer 1.100 1.6e-03
non primary Sjogren syndrome sicca 1.100 2.4e-02
ovarian cancer 1.700 7.2e-07

Gene RIF (53)

PMID Text
26755727 there is no difference in lysine acetylation of substrate proteins with or without Naa10, suggesting that the substrates may be acetylated chemically rather than enzymatically.
26646451 The results observed an inverse correlation between the expression of NAA10 and that of miR-342-5p and miR-608 .
26522270 The clinical spectrum of NAA10.
25987439 Naa10 structure and function. [Review]
25854368 Combined high expression of Naa10p, SNCG and PRL-3 are associated with lymph node metastasis in breast cancer.
25421966 human ARD1 variants have different effects on cell proliferation, which may result from distinct subcellular localizations and autoacetylation activities.
25341044 ARD1 has a crucial role in the cellular response to oxidative stress as a bona fide regulator of MSRA.
25338643 Autoacetylation of ARD1 variants differentially regulates angiogenesis and cell proliferation in an isoform-specific manner.
25133627 results show that hARD1 nuclear translocation mediated by NLS is required for cell cycle progression, thereby contributing to proper cell proliferation.
25099252 De novo missense mutations in the NAA10 gene cause severe non-syndromic developmental delay in males and females
24925029 Naa10p inhibits the metastasis of breast cancer cells by targeting STAT5a.
24431331 The study concludes that the NAA10 mutation is the cause of Lenz microphthalmia syndrome in a family, likely through the dysregulation of the retinoic acid signalling pathway.
24408909 Study describes a Saccharomyces cerevisiae model developed by introducing the human wild-type (wt) or mutant NatA complex into yeast lacking NatA (NatA-Delta). The wt human NatA complex phenotypically complemented the NatA-Delta strain, whereas only a partial rescue was observed for the Ogden mutant NatA complex suggesting that hNaa10 S37P is only partially functional in vivo.
23624078 Naa10p suppresses 28S proteasome activity through interaction with PA28beta.
23557624 Development of the first specific NAT-inhibitors, including inhibitors targeting Naa10.
23550278 The expression level of NAA10 is inversely correlated with that of MMP-9 in breast cancer samples.
23043182 Protein N-terminal acetyltransferases (NATs), including Naa10, act as N-terminal propionyltransferases.
22580278 These data indicate that the interaction between ARD1 and RIP1 plays an important role in the DNA damage-induced NF-kappaB activation, and that the acetyltransferase activity of ARD1 and its localization in to the nucleus are involved in such stress response.
22496479 study revealed a novel mechanism controlling MCL1 expression, in which Naa10p and RelA/p65 synergistically interact with MCL1 promoter region and promote MCL1 transcription
22315407 ARD1 functions as a unique AR regulator in prostate cancer cells.
22261620 Arrest-defective protein 1 homolog A (ARD1) in combination with SNCG/Hiwi/PRL-3 may lead to a poor outcome in patients with or without lymph node metastatic colon cancer.
21700266 A reduction in acetylation by hNaa10p causes lethal X-linked disorder of infancy.
21383206 N(alpha)-acetyltransferase 10 may function as a post-translational actin N(alpha)-acetyltransferase.
21295525 suggest that Naa10p functions as a tumor metastasis suppressor by disrupting the migratory complex, PIX-GIT- Paxillin, in cancer cells
20639454 These results indicate that ARD1A is a novel tumor-associated antigen and a potential prognostic factor for colon cancer.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20592467 interaction between hNaa10p and DNMT1 was required for E-cadherin silencing through promoter CpG methylation, and E-cadherin repression contributed to the oncogenic effects of hNaa10p.
20501853 Results show that hARD1 autoacetylation is critical for its activation and its ability to stimulate cancer cell proliferation and tumorigenesis.
20154145 Data indicate that the physical interaction between HYPK and NatA Naa10/15 seems to be of functional importance both for huntingtin aggregation and for N-terminal acetylation.
20145209 ARD1 functions as an inhibitor of the mTOR pathway and that dysregulation of the ARD1-TSC2-mTOR axis may contribute to cancer development
19913121 Observational study of gene-disease association. (HuGE Navigator)
19909012 Results suggest that hARD1 might play an important role in breast cancer carcinogenesis.
19826488 hARD1 is a bona fide regulator of MLCK, and hARD1 plays a crucial role in the balance between tumor cell migration and stasis
19716809 ARD1 is indeed a bona fide substrate of IKKbeta.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19287988 accumulation of hARD1 protein may be related to carcinogenesis of various types of cancer.
18991565 This review focuses on the enzymatic and biological activities of human ARD1, the reduction of which negatively affects cell growth and may be a potential cancer drug target.
18794801 ARD1A is implicated in cellular proliferation and carcinogenesis.
18593917 HIF-1alpha was found to inactivate the Wnt signaling by binding to hARD1 or beta-catenin, which may contribute to the hypoxia-induced growth arrest of tumor cells.
17161380 These results indicate that ARD1(235) and ARD1(225) isoforms may have different activities and function in different subcellular compartments of mammalian cells.
16823041 Structural characterization of native hARD1 using size exclusion chromatography, circular dichroism, & fluorescence spectroscopy shows the protein consists of compact globular region comprising 2 thirds of the protein & a flexible unstructured C terminus.
16518407 Essential role in cell survival through protein N-alpha-acetylation.
16376303 A human ARD1 variant ortholog (235) has weak effects on hypoxia inducible factor (HIF)-1 alpha and VEGF mRNA stability compared to mouse ARD1 ortholog 225.
16288748 ARD1 specifically binds HIF-1 alpha, suggesting a putative, still unclear, connection between these proteins.
16279846 levels of endogenous NATH and hARD1 proteins in thyroid papillary carcinoma patients; results suggest that NATH positively affects the level of hARD1 protein both in vivo and in cell cultures
15994306 Data demonstrate that ARD1 has limited, if any, impact on the HIF-1alpha signaling pathway.
15755738 ARD1 is involved in cell proliferation and in regulating a series of cellular metabolic pathways that are regulated during hypoxia response.
15749829 Amino-terminal acetyltransferase ARD1 (hARD1) interacts with a novel motif, 658-HGVVEVD-664, in the cytoplasmic domain of beta-amyloid precursor protein.
15496142 Human Naa15 (NATH) and Naa10 (ARD1) form a stable NatA complex which associates with ribosomes and performs co-translational N-terminal acetylation; Naa15 (NATH) and Naa10 (ARD1) are cleaved during apoptosis resulting in decreased acetyltransferase activity
15496142 description of the human homologue of Nat1p, NATH (NAT human), as the binding partner of the hARD1 (human ARD1) protein
15496142 hARD1 complexes with NATH in a ribosomal associated protein-N-acetyltransferase complex.
12464182 ARD1-mediated acetylation regulates and destabilizes HIF-1 alpha by directly binding to it.
11393533 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHG      1 - 70
HITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYAD     71 - 140
GEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSK    141 - 210
DLSEVSETTESTDVKDSSEASDSAS                                                 211 - 235
//

Text Mined References (78)

PMID Year Title
26755727 2016 The N-terminal Acetyltransferase Naa10/ARD1 Does Not Acetylate Lysine Residues.
26646451 2016 microRNA-342-5p and miR-608 inhibit colon cancer tumorigenesis by targeting NAA10.
26522270 2015 NAA10 mutation causing a novel intellectual disability syndrome with Long QT due to N-terminal acetyltransferase impairment.
25987439 2015 The biological functions of Naa10 - From amino-terminal acetylation to human disease.
25854368 2015 Combined expression of metastasis related markers Naa10p, SNCG and PRL-3 and its prognostic value in breast cancer patients.
25421966 2015 Different subcellular localizations and functions of human ARD1 variants.
25416956 2014 A proteome-scale map of the human interactome network.
25341044 2014 Arrest defective 1 regulates the oxidative stress response in human cells and mice by acetylating methionine sulfoxide reductase A.
25338643 2015 Autoacetylation regulates differentially the roles of ARD1 variants in tumorigenesis.
25133627 2014 Nuclear translocation of hARD1 contributes to proper cell cycle progression.
25099252 2015 De novo missense mutations in the NAA10 gene cause severe non-syndromic developmental delay in males and females.
24925029 2014 Inhibition of STAT5a by Naa10p contributes to decreased breast cancer metastasis.
24431331 2014 A splice donor mutation in NAA10 results in the dysregulation of the retinoic acid signalling pathway and causes Lenz microphthalmia syndrome.
24408909 2014 A Saccharomyces cerevisiae model reveals in vivo functional impairment of the Ogden syndrome N-terminal acetyltransferase NAA10 Ser37Pro mutant.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23624078 2013 N-?-acetyltransferase 10 protein is a negative regulator of 28S proteasome through interaction with PA28?.
23557624 2013 Design, synthesis, and kinetic characterization of protein N-terminal acetyltransferase inhibitors.
23550278 2013 Inverse correlation between Naa10p and MMP-9 expression and the combined prognostic value in breast cancer patients.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23043182 2013 Protein N-terminal acetyltransferases act as N-terminal propionyltransferases in vitro and in vivo.
22580278 2012 ARD1 binding to RIP1 mediates doxorubicin-induced NF-?B activation.
22496479 2012 N-?-acetyltransferase 10 protein inhibits apoptosis through RelA/p65-regulated MCL1 expression.
22315407 2012 Inactivation of androgen-induced regulator ARD1 inhibits androgen receptor acetylation and prostate tumorigenesis.
22261620 2012 Combined phenotype of 4 markers improves prognostic value of patients with colon cancer.
21700266 2011 Using VAAST to identify an X-linked disorder resulting in lethality in male infants due to N-terminal acetyltransferase deficiency.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21383206 2011 Proteome-derived peptide libraries allow detailed analysis of the substrate specificities of N(alpha)-acetyltransferases and point to hNaa10p as the post-translational actin N(alpha)-acetyltransferase.
21295525 2011 N-?-acetyltransferase 10 protein suppresses cancer cell metastasis by binding PIX proteins and inhibiting Cdc42/Rac1 activity.
21269460 2011 Initial characterization of the human central proteome.
20639454 2010 Peptide mimic isolated by autoantibody reveals human arrest defective 1 overexpression is associated with poor prognosis for colon cancer patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20592467 2010 hNaa10p contributes to tumorigenesis by facilitating DNMT1-mediated tumor suppressor gene silencing.
20501853 2010 Arrest defective 1 autoacetylation is a critical step in its ability to stimulate cancer cell proliferation.
20154145 2010 The chaperone-like protein HYPK acts together with NatA in cotranslational N-terminal acetylation and prevention of Huntingtin aggregation.
20145209 2010 ARD1 stabilization of TSC2 suppresses tumorigenesis through the mTOR signaling pathway.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19909012 2009 Correlation of expression of human arrest-defective-1 (hARD1) protein with breast cancer.
19826488 2009 Arrest defective-1 controls tumor cell behavior by acetylating myosin light chain kinase.
19716809 2009 Phosphorylation of ARD1 by IKKbeta contributes to its destabilization and degradation.
19660095 2009 A synopsis of eukaryotic Nalpha-terminal acetyltransferases: nomenclature, subunits and substrates.
19480662 2009 A novel human NatA Nalpha-terminal acetyltransferase complex: hNaa16p-hNaa10p (hNat2-hArd1).
19420222 2009 Proteomics analyses reveal the evolutionary conservation and divergence of N-terminal acetyltransferases from yeast and humans.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19287988 2009 Immunohistochemical analysis of human arrest-defective-1 expressed in cancers in vivo.
18991565 2008 The protein acetyltransferase ARD1: a novel cancer drug target?
18794801 2008 Implication of human N-alpha-acetyltransferase 5 in cellular proliferation and carcinogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18593917 2008 Hypoxia-inducible factor-1alpha obstructs a Wnt signaling pathway by inhibiting the hARD1-mediated activation of beta-catenin.
17161380 2007 Differential regulation of splicing, localization and stability of mammalian ARD1235 and ARD1225 isoforms.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16823041 2006 Characterization of the native and fibrillar conformation of the human Nalpha-acetyltransferase ARD1.
16638120 2006 Characterization of hARD2, a processed hARD1 gene duplicate, encoding a human protein N-alpha-acetyltransferase.
16518407 2006 Induction of apoptosis in human cells by RNAi-mediated knockdown of hARD1 and NATH, components of the protein N-alpha-acetyltransferase complex.
16507339 2006 Cloning and characterization of hNAT5/hSAN: an evolutionarily conserved component of the NatA protein N-alpha-acetyltransferase complex.
16381901 2006 The LIFEdb database in 2006.
16376303 2006 Characterization of ARD1 variants in mammalian cells.
16288748 2005 Interaction between HIF-1 alpha (ODD) and hARD1 does not induce acetylation and destabilization of HIF-1 alpha.
16279846 2005 Expression of N-acetyl transferase human and human Arrest defective 1 proteins in thyroid neoplasms.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15994306 2005 Arrest-defective-1 protein, an acetyltransferase, does not alter stability of hypoxia-inducible factor (HIF)-1alpha and is not induced by hypoxia or HIF.
15772651 2005 The DNA sequence of the human X chromosome.
15755738 2005 Analysis of ARD1 function in hypoxia response using retroviral RNA interference.
15749829 2005 Interaction of N-terminal acetyltransferase with the cytoplasmic domain of beta-amyloid precursor protein and its effect on A beta secretion.
15496142 2005 Identification and characterization of the human ARD1-NATH protein acetyltransferase complex.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12888564 2003 An evolutionarily conserved N-terminal acetyltransferase complex associated with neuronal development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464182 2002 Regulation and destabilization of HIF-1alpha by ARD1-mediated acetylation.
11393533 2001 Identification of single-nucleotide polymorphisms (SNPs) of human N-acetyltransferase genes NAT1, NAT2, AANAT, ARD1 and L1CAM in the Japanese population.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7981673 1994 Isolation of new genes in distal Xq28: transcriptional map and identification of a human homologue of the ARD1 N-acetyl transferase of Saccharomyces cerevisiae.