Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.75
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia -1.600 6.2e-03
aldosterone-producing adenoma -1.166 2.0e-02
atypical teratoid / rhabdoid tumor -2.200 7.1e-06
Breast cancer -2.000 1.6e-12
colon cancer -1.100 2.1e-02
ependymoma -1.700 4.8e-03
glioblastoma -1.100 1.2e-05
group 4 medulloblastoma -1.200 2.6e-02
Hydrolethalus syndrome 1.169 3.9e-02
intraductal papillary-mucinous carcinoma... -1.100 1.1e-02
invasive ductal carcinoma -1.200 4.6e-03
lung cancer -1.700 1.2e-02
malignant mesothelioma -1.700 4.4e-05
medulloblastoma, large-cell -3.300 5.2e-05
non-small cell lung cancer -2.041 6.0e-23
oligodendroglioma -1.500 2.5e-03
osteosarcoma -2.050 4.8e-04
ovarian cancer -2.300 6.2e-08
pediatric high grade glioma -1.100 3.0e-03
Pick disease -1.400 3.8e-04
pituitary cancer 1.100 6.9e-05
primitive neuroectodermal tumor -1.400 8.9e-04
psoriasis -1.600 1.3e-07

Gene RIF (3)

AA Sequence

MEDSFLQSFGRLSLQPQQQQQRQRPPRPPPRGTPPRRHSFRKHLYLLRGLPGSGKTTLARQLQHDFPRAL      1 - 70
IFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTNLHAWEMKPYAVMALENNYEV     71 - 140
IFREPDTRWKFNVQELARRNIHGVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNAR    141 - 210
YWNSYTEFPNRRAHGGFTNESSYHRRGGCHHGY                                         211 - 243
//

Text Mined References (9)

PMID Year Title