Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma -1.500 4.9e-03
intraductal papillary-mucinous adenoma (... -1.100 2.0e-03
intraductal papillary-mucinous neoplasm ... -1.100 1.4e-02
ovarian cancer 1.300 7.1e-03

Gene RIF (3)

AA Sequence

MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGGIDPDVFKILVDLLKLNVAPL      1 - 70
AVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRDKGSAALGGVLALAERSNHEGSSQRMPRQPSA     71 - 140
TRLPKGGGPGKSPTQGST                                                        141 - 158
//

Text Mined References (10)

PMID Year Title