Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.23
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -2.600 5.7e-03
ependymoma -2.200 1.2e-02
oligodendroglioma -2.100 2.5e-02
glioblastoma -2.000 3.5e-06
atypical teratoid / rhabdoid tumor -1.600 3.5e-05
intraductal papillary-mucinous neoplasm ... 1.100 1.0e-02
adult high grade glioma -1.700 4.3e-04
pilocytic astrocytoma -1.600 4.9e-05
subependymal giant cell astrocytoma -2.018 9.7e-03

Synonym

Accession Q08AG7 Q5W0P5
Symbols MOZART1
C13orf37

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

AA Sequence

MASSSGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKA      1 - 70
TEALKAAENMTS                                                               71 - 82
//

Text Mined References (9)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
22889921 2013 Genome-wide association study of obsessive-compulsive disorder.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22427335 2012 The GCP3-interacting proteins GIP1 and GIP2 are required for ?-tubulin complex protein localization, spindle integrity, and chromosomal stability.
21269460 2011 Initial characterization of the human central proteome.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.