Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.28
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.700 4.3e-04
astrocytic glioma -2.600 5.7e-03
Astrocytoma, Pilocytic -1.600 4.9e-05
atypical teratoid / rhabdoid tumor -1.600 3.5e-05
ependymoma -2.200 1.2e-02
glioblastoma -1.200 3.4e-05
intraductal papillary-mucinous neoplasm ... 1.100 1.0e-02
oligodendroglioma -2.100 2.5e-02
subependymal giant cell astrocytoma -2.018 9.7e-03

 GO Function (1)

Gene RIF (2)

AA Sequence

MASSSGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKA      1 - 70
TEALKAAENMTS                                                               71 - 82
//

Text Mined References (11)

PMID Year Title