Property Summary

NCBI Gene PubMed Count 15
PubMed Score 17.34
PubTator Score 37.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
oligodendroglioma 2.300 1.3e-02
astrocytoma 1.100 2.5e-05
osteosarcoma -2.247 3.0e-05
ependymoma -1.100 3.3e-03
group 4 medulloblastoma 2.800 1.5e-04
atypical teratoid / rhabdoid tumor -1.400 7.5e-03
medulloblastoma, large-cell 1.900 4.4e-04
pilocytic astrocytoma 2.300 2.4e-05
subependymal giant cell astrocytoma -3.195 3.9e-03
lung carcinoma 2.200 4.7e-47

Gene RIF (5)

PMID Text
23146904 although depletion of MYT1 alone did not affect long-term cell growth, it potentiated with DNA damage to inhibit cell growth in clonogenic survival and tumor xenograft models
19204086 UVA-induced caspase-3 cleavage and DNA fragmentation were suppressed by the knockdown of human Myt1 in skin cancer cells.
18950845 Observational study of gene-disease association. (HuGE Navigator)
17330875 These results suggesta potential role for Myt1 in the regeneration of oligodendrocyte lineage cells in response to demyelination.
12524179 present in brain in infancy and prenatally in infants with periventricular leukomalacia

AA Sequence

MSLENEDKRARTRSKALRGPPETTAADLSCPTPGCTGSGHVRGKYSRHRSLQSCPLAKKRKLEGAEAEHL      1 - 70
VSKRKSHPLKLALDEGYGVDSDGSEDTEVKDASVSDESEGTLEGAEAETSGQDEIHRPETAEGRSPVKSH     71 - 140
FGSNPIGSATASSKGSYSSYQGIIATSLLNLGQIAEETLVEEDLGQAAKPGPGIVHLLQEAAEGAASEEG    141 - 210
EKGLFIQPEDAEEVVEVTTERSQDLCPQSLEDAASEESSKQKGILSHEEEDEEEEEEEEEEEEDEEEEEE    211 - 280
EEEEEEEEEEEEEEEEEEEEEEEEEEAAPDVIFQEDTSHTSAQKAPELRGPESPSPKPEYSVIVEVRSDD    281 - 350
DKDEDTHSRKSTVTDESEMQDMMTRGNLGLLEQAIALKAEQVRTVCEPGCPPAEQSQLGLGEPGKAAKPL    351 - 420
DTVRKSYYSKDPSRAEKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPG    421 - 490
CTGQGHVNSNRNTHRSLSGCPIAAAEKLAKSHEKQQPQTGDPSKSSSNSDRILRPMCFVKQLEVPPYGSY    491 - 560
RPNVAPATPRANLAKELEKFSKVTFDYASFDAQVFGKRMLAPKIQTSETSPKAFQCFDYSQDAEAAHMAA    561 - 630
TAILNLSTRCWEMPENLSTKPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPSSSSCSSSPGVKSPDA    631 - 700
SQRHSSTSAPSSSMTSPQSSQASRQDEWDRPLDYTKPSRLREEEPEESEPAAHSFASSEADDQEVSEENF    701 - 770
EERKYPGEVTLTNFKLKFLSKDIKKELLTCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAHSA    771 - 840
DLKCPTPGCDGSGHITGNYASHRSLSGCPRAKKSGVKVAPTKDDKEDPELMKCPVPGCVGLGHISGKYAS    841 - 910
HRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKKG    911 - 980
KLSGDEVLSPKFKTSDVLENDEEIKQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIE    981 - 1050
EQNEALFLELSGLSQALIQSLANIRLPHMEPICEQNFDAYVSTLTDMYSNQDPENKDLLESIKQAVRGIQ   1051 - 1120
V//

Text Mined References (17)

PMID Year Title
23146904 2013 The CDK1 inhibitory kinase MYT1 in DNA damage checkpoint recovery.
19204086 2009 c-Jun N-terminal kinase 1 phosphorylates Myt1 to prevent UVA-induced skin cancer.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17330875 2007 Myelin transcription factor 1 (Myt1) expression in demyelinated lesions of rodent and human CNS.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14962745 2004 Myelin transcription factor 1 (Myt1) modulates the proliferation and differentiation of oligodendrocyte lineage cells.
12606722 2003 The p53-inducible TSAP6 gene product regulates apoptosis and the cell cycle and interacts with Nix and the Myt1 kinase.
12524179 2003 Myelin transcription factor 1 (MyT1) immunoreactivity in infants with periventricular leukomalacia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9373037 1997 Myelin transcription factor 1 (Myt1) of the oligodendrocyte lineage, along with a closely related CCHC zinc finger, is expressed in developing neurons in the mammalian central nervous system.
8530187 1995 Expression of myelin transcription factor I (MyTI), a "zinc-finger" DNA-binding protein, in developing oligodendrocytes.
7519254 1994 Plasticity in the adult human oligodendrocyte lineage.
1280325 1992 Novel member of the zinc finger superfamily: A C2-HC finger that recognizes a glia-specific gene.