Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.58
PubTator Score 11.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -2.500 6.9e-03
ependymoma -2.000 8.3e-03
oligodendroglioma -2.300 9.7e-03
glioblastoma -3.000 2.7e-04
osteosarcoma -1.638 1.7e-02
sonic hedgehog group medulloblastoma -2.300 1.2e-04
atypical teratoid / rhabdoid tumor -3.600 9.2e-07
medulloblastoma, large-cell -4.000 2.5e-07
primitive neuroectodermal tumor -3.000 5.0e-05
non-small cell lung cancer -1.281 5.3e-11
intraductal papillary-mucinous adenoma (... -2.400 7.3e-04
intraductal papillary-mucinous neoplasm ... -3.100 1.1e-03
lung cancer 2.000 2.7e-04
active Crohn's disease 1.398 1.4e-02
pancreatic cancer -1.700 9.5e-06
adult high grade glioma -2.600 1.5e-04
pilocytic astrocytoma -1.100 2.6e-03
lung adenocarcinoma -1.100 2.5e-10
gastric carcinoma -2.900 2.7e-02
ductal carcinoma in situ -1.300 6.6e-04
invasive ductal carcinoma -1.300 8.3e-03

Gene RIF (11)

PMID Text
26675235 The role of MyRIP in Ca(2+)-driven exocytosis requires both MyoVa- and actin-binding potential.
22396429 Myrip couples the retention of secretory granules in the cell cortex, their transport to the plasma membrane, and their attachment to the plasma membrane, thus promoting secretion.
21740491 A Rab27a/MyRIP/myosin Va complex is involved in linking von-Willebrand factor (Vwf) to the peripheral actin cytoskeleton of endothelial cells to allow full maturation and prevent premature secretion of vWF.
20861866 A new potentially protective effect was identified at rs2679798 in MYRIP.
20861866 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19270261 Rab27a and MyRIP regulate the amount and multimeric state of VWF released from endothelial cells.
18478159 During primate spermiogenesis, dynein, myosin Va, MyRIP and Rab27b that compose microtubule-based and actin-based vesicle transport systems are actually present in the manchette and might possibly be involved in intramanchette transport.
14517322 Slac2c/MyRIP is part of a complex mediating the interaction of secretory granules with cortical actin cytoskeleton
12221080 Slac2-c/MyRIP contains an N-terminal Slp homology domain (SHD) and functions as a linker protein that interacts with myosin Rab27A/B, VIIa/Va, and actin.
11964381 a molecular complex composed of Rab27A, MyRIP and myosin VIIa bridges retinal melanosomes to the actin cytoskeleton and thereby mediates the local trafficking of these organelles

AA Sequence

MGRKLDLSGLTDDETEHVLQVVQRDFNLRKKEEERLSELKQKLDEEGSKCSILSKHQQFVEHCCMRCCSP      1 - 70
FTFLVNTKRQCGDCKFNVCKSCCSYQKHEKAWVCCVCQQARLLRAQSLEWFYNNVKSRFKRFGSAKVLKN     71 - 140
LYRKHRLESGACFDILGGSLFESNLENEGSISGSDSTFYRQSEGHSVMDTLAVALRVAEEAIEEAISKAE    141 - 210
AYGDSLDKQNEASYLRDHKEELTEELATTILQKIIRKQKSKSEQQVEEEPGWPHPQSCSTKVADEGTSAS    211 - 280
PGGYRAPAALWRSQSAFSITGEEALKTPPVEAPSRQPRDQGQHPRAESALPSWKSVDRLDETNLAPVLQS    281 - 350
PDGNWVALKDGAPPPTRLLAKPKSGTFQALEVASSVASAYDEMGSDSEEDFDWSEALSKLCPRSRALPRN    351 - 420
PQPQPTQAQSSDQGPIAASPSSALSPNPEAMCSDSETSSAGSSREVGHQARLSWLQRKAPRNPAAEKMRL    421 - 490
HGELDVNFNPQLASRETSDSSEPEEAPHTTDRRARRWRRARLGSEEPSKEPSSPSAQLRDLDTHQVSDDL    491 - 560
SETDISNEARDPQTLTDTTEEKRRNRLYELAMKMSEKETSSGEDQESEPKTESENQKESLSSEDNSQSVQ    561 - 630
EELKKKFSAVSLCNISTEVLKVINATEELIAGSTGPWESPQVPPDRQKGMFPRGTDQVRLDEQLTSLEEN    631 - 700
VYLAAGTVYGLETQLTELEDAARCIHSGTDETHLADLEDQVATAAAQVHHAELQISDIESRISALTIAGL    701 - 770
NIAPCVRFTRRRDQKQRTQVQTIDTSRQQRRKLPAPPVKAEKIETSSVTTIKTFNHNFILQGSSTNRTKE    771 - 840
RKGTTKDLMEPALESAVMY                                                       841 - 859
//

Text Mined References (23)

PMID Year Title
26675235 2016 Interaction between MyRIP and the actin cytoskeleton regulates Weibel-Palade body trafficking and exocytosis.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23007406 2012 Genome-wide association study identifies germline polymorphisms associated with relapse of childhood acute lymphoblastic leukemia.
22396429 2012 Myrip couples the capture of secretory granules by the actin-rich cell cortex and their attachment to the plasma membrane.
21740491 2011 Myosin Va acts in concert with Rab27a and MyRIP to regulate acute von-Willebrand factor release from endothelial cells.
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
20861866 2010 Genome-wide association identifies SKIV2L and MYRIP as protective factors for age-related macular degeneration.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19270261 2009 Rab27a and MyRIP regulate the amount and multimeric state of VWF released from endothelial cells.
18478159 2008 Intramanchette transport during primate spermiogenesis: expression of dynein, myosin Va, motor recruiter myosin Va, VIIa-Rab27a/b interacting protein, and Rab27b in the manchette during human and monkey spermiogenesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903308 2007 Genome-wide association of sleep and circadian phenotypes.
17827149 2007 MyRIP anchors protein kinase A to the exocyst complex.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14517322 2003 Involvement of the Rab27 binding protein Slac2c/MyRIP in insulin exocytosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221080 2002 Slac2-c (synaptotagmin-like protein homologue lacking C2 domains-c), a novel linker protein that interacts with Rab27, myosin Va/VIIa, and actin.
11964381 2002 MyRIP, a novel Rab effector, enables myosin VIIa recruitment to retinal melanosomes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.