Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.31
PubTator Score 96.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 8.0e-06
osteosarcoma 1.923 7.3e-10
medulloblastoma, large-cell 1.100 7.0e-04
acute quadriplegic myopathy -1.691 3.5e-08

Synonym

Accession Q8TDC0 B2R9Q4 D3DQG9 Q8IVM1 Q8IVN1
Symbols CS3
CS-3
FRP3

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
19472918 Observational study of gene-disease association. (HuGE Navigator)
11842093 Calsarcin-3, a novel skeletal muscle-specific member of the calsarcin family, interacts with multiple Z-disc proteins.

AA Sequence

MIPKEQKGPVMAAMGDLTEPVPTLDLGKKLSVPQDLMMEELSLRNNRGSLLFQKRQRRVQKFTFELAASQ      1 - 70
RAMLAGSARRKVTGTAESGTVANANGPEGPNYRSELHIFPASPGASLGGPEGAHPAAAPAGCVPSPSALA     71 - 140
PGYAEPLKGVPPEKFNHTAISKGYRCPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTF    141 - 210
PRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL                                 211 - 251
//

Text Mined References (9)

PMID Year Title
19472918 2008 Candidate-gene testing for orphan limb-girdle muscular dystrophies.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11842093 2002 Calsarcin-3, a novel skeletal muscle-specific member of the calsarcin family, interacts with multiple Z-disc proteins.
10427098 1999 ZASP: a new Z-band alternatively spliced PDZ-motif protein.