Property Summary

NCBI Gene PubMed Count 28
PubMed Score 15.87
PubTator Score 33.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 16 1 0.0 0.0
Disease Target Count
Left Ventricular Hypertrophy 47
Disease Target Count P-value
juvenile dermatomyositis 1187 1.4e-07
malignant mesothelioma 3232 1.9e-03
nephrosclerosis 333 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hypertrophic Cardiomyopathy 117 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 4.14 2.1
Disease Target Count Z-score Confidence
Hypertrichotic osteochondrodysplasia Cantu type 5 3.955 2.0
Disease Target Count
hypertrophic cardiomyopathy 16 1

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.166 1.4e-07
malignant mesothelioma -1.100 1.9e-03
nephrosclerosis 1.086 1.6e-02

Gene RIF (8)

AA Sequence

MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTF      1 - 70
ENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFN     71 - 140
TTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFE    141 - 210
LLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL                    211 - 264
//

Text Mined References (27)

PMID Year Title