Property Summary

NCBI Gene PubMed Count 96
PubMed Score 54.24
PubTator Score 171.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Liver cancer 604 0.0 0.6
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 5.21 2.6
Cardiomyopathy 116 0.0 4.0
Disease Target Count Z-score Confidence
Sensorineural hearing loss 106 3.808 1.9
Disease Target Count
Deafness, autosomal dominant 22 1

Expression

  Differential Expression (18)

Disease log2 FC p
Breast cancer 3.000 4.3e-02
Down syndrome 1.300 1.1e-03
ductal carcinoma in situ 1.600 1.7e-02
fibroadenoma 1.100 3.2e-02
gastric carcinoma 1.200 1.1e-02
interstitial cystitis -1.400 3.2e-03
intraductal papillary-mucinous adenoma (... 1.200 3.4e-03
intraductal papillary-mucinous carcinoma... 1.500 4.2e-03
invasive ductal carcinoma 1.500 1.3e-02
lung adenocarcinoma 1.610 8.4e-06
lung cancer -1.100 6.8e-04
malignant mesothelioma -2.400 3.7e-07
ovarian cancer 1.700 3.7e-04
Pick disease -1.100 4.1e-04
progressive supranuclear palsy -1.200 4.7e-02
sonic hedgehog group medulloblastoma -1.400 3.4e-03
spina bifida -2.817 3.6e-02
tuberculosis -1.200 1.6e-02

Synonym

Accession Q9UM54 A6H8V4 E1P540 Q5TEM5 Q5TEM6 Q5TEM7 Q9BZZ7 Q9UEG2
Symbols DFNA22
DFNB37
Myo6-007
Myo6-008

Gene

Protein-protein Interaction (6)

Gene RIF (59)

AA Sequence

MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNE      1 - 70
ATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKV     71 - 140
LKMSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFV    141 - 210
EIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTR    211 - 280
YFANKETDKQILQNRKSPEYLKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNI    281 - 350
DFEEAGSTSGGCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNAR    351 - 420
DALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILK    421 - 490
EEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLTIP    491 - 560
RKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESRDKFIRELFESSTNNNKD    561 - 630
TKQKAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDL    631 - 700
MQGGYPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIM    701 - 770
KSDPDHLAELVKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGL    771 - 840
VKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKSTMMTQEQIQKEYDALVKSSEELL    841 - 910
SALQKKKQQEEEAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKR    911 - 980
IQAEVEAQLARQKEEESQQQAVLEQERRDRELALRIAQSEAELISDEAQADLALRRSLDSYPVSKNDGTR    981 - 1050
PKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKV   1051 - 1120
YHAWKSKNKKRNTETEQRAPKSVTDYDFAPFLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQ   1121 - 1190
YKDPQSKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEE   1191 - 1260
IWERCGGIQYLQNAIESRQARPTYATAMLQSLLK                                       1261 - 1294
//

Text Mined References (101)

PMID Year Title