Property Summary

NCBI Gene PubMed Count 89
PubMed Score 49.92
PubTator Score 171.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -2.400 3.7e-07
tuberculosis -1.200 1.6e-02
intraductal papillary-mucinous adenoma (... 1.200 3.4e-03
intraductal papillary-mucinous carcinoma... 1.500 4.2e-03
lung cancer -1.100 6.8e-04
fibroadenoma 1.100 3.2e-02
Breast cancer 3.000 4.3e-02
interstitial cystitis -1.600 1.2e-04
sonic hedgehog group medulloblastoma -1.400 3.4e-03
lung adenocarcinoma 1.610 8.4e-06
spina bifida -2.817 3.6e-02
Pick disease -1.100 4.1e-04
progressive supranuclear palsy -1.400 6.6e-03
gastric carcinoma 1.200 1.1e-02
ductal carcinoma in situ 1.900 1.5e-03
invasive ductal carcinoma 1.800 1.5e-03
ovarian cancer 1.700 3.7e-04
Down syndrome 1.300 1.1e-03

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (52)

PMID Text
27018747 Interaction of myosin VI and its binding partner DOCK7 plays an important role in NGF-stimulated protrusion formation in PC12 cells.
26950368 This study identified an isoform-specific regulatory helix, named the alpha2-linker, that defines specific conformations and hence determines the target selectivity of human myosin VI.
26451915 we demonstrate that myosin VI and TAX1BP1 are recruited to ubiquitylated Salmonella and play a key role in xenophagy
26407123 Knockdown of MYO6 markedly reduced cell viability and colony formation, as well as suppressed cell cycle progression in breast cancer cells.
26324058 Knockdown of myosin VI significantly suppressed melanoma cell viability and proliferation.
26263762 Several postulated mechanisms of function for actin cytoskeleton and MVI during subsequent steps of clathrin-dependent endocytosis are discussed in this review.
25999546 Four mutations of MYO6 protein were found in seven Japanese families exhibiting autosomal dominant inheritance of hearing loss.
25859013 Optineurin binding to myosin VI was also decreased in tissue lysates from sporadic amyotrophic lateral sclerosis spinal cords.
25703929 MYO6 was highly expressed in hepatocellular carcinoma.
25643992 MYO6 is crucial in maintaining cell cycle and cell growth of lung cancer cells.MYO6 is highly expressed in human lung cancer tissues.
25227905 The frameshift deletion in MYO6 was confirmed as the causative variant for this dominant nonsyndromic hearing loss DFNA22 family
25125183 In myopathies associated with fiber atrophy, the amount of MVI was enhanced and its localization in affected fibers was changed.
25080041 Three mutations (p.R825X, p.R991X and Q918fsX941) produce a premature truncation of the myosin VI protein. p.R205Q, was associated with diminished actin-activated ATPase activity and actin gliding velocity of myosin VI in an in vitro analysis.
24928903 Myosin VI mediates the movement of NHE3 to the microvillus in intestinal epithelial cells.
24105371 Data indicate nine novel mutations in the genes encoding myosin VI, myosin VIIA and myosin XVA in hearing-impaired individuals from Israeli Jewish and Palestinian Arab families.
24028494 Myo6 plays a critical role in the fusion of endosome/lysosome in Rmc epithelial cells. Deficiency of myo6 compromises the epithelial barrier function
23635807 we identified a novel MYO6 mutation at the splice acceptor site of exon 7 (c.554-1G>A) in an extended German family with autosomal dominant postlingual non-syndromic hearing impairment.
23340379 Report Dutch family with progressive autosomal dominant sensorineural hearing loss caused by a mutation in MYO6 resembling presbyacusis.
23023224 It was shown that that myosin VI, in concert with Tom1, plays a crucial role in autophagy. Tom1 was identified as a myosin VI binding partner on endosomes.
23007415 The central regions of the cadherin tail adjacent to the juxtamembrane sequence also display binding activity for Myo VI-CBD.
22992744 analysis of the dynamic exchange of myosin VI on endocytic structures
22884421 detailed kinetic characterization of the myosin-6 motor domain
22321127 myosin VI regulates the organization of actin dynamics at the surface of a specialized organelle
22171985 Studies from crystallographic structures of myosin VI have revealed that rearrangements within the converter subdomain occur.
21735821 In this review, we describe the structure, kinetic properties and functions proposed for myosin VI, and present current hypotheses on the mechanisms of functioning of this unique protein in vivo.
21278381 Role of insert-1 of myosin VI in modulating nucleotide affinity.
21148290 results suggest a novel role for myosin VI and optineurin in regulation of fusion pores formed between secretory vesicles and the plasma membrane during the final stages of secretion
20850010 Study suggests 2 tilt angles during myo6 stepping, corresponding to the pre- & post powerstroke states regulating leading head; large steps with hand-over-hand mechanism & small steps with inchworm-like mechanism increasing in frequency with ADP.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20604900 In migratory cells ablation of myosin VI or optineurin inhibits the polarized delivery of the epidermal growth factor receptor into the leading edge and leads to profound defects in lamellipodia formation.
20576604 Myosin VI is differentially regulated by DNA damage in p53- and cell type-dependent manners.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20353999 Our data indicate that miR-143 and miR-145 are involved in the regulation of MYO6 expression and possibly in the development of prostate cancer.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19893302 This study describes the phenotype of 2 Belgian families with SNHL linked to DFNA22, both with a pathogenic change in the deafness gene MYO6.
19855435 Data show that downregulation of myosin VI expression results in a significant reduction in PSA and VEGF secretion in LNCaP cells, and the intracellular targeting seems to involve myosin VI-interacting proteins, GIPC and LMTK2 and Dab2.
18543251 Golgi apparatus in prostate cancer cells differs from the normal Golgi by elevated levels of two molecules, GOLPH2 and MYO6.
18429820 Results show that BREK is critical for the transition of endocytosed membrane vesicles from early endosomes to recycling endosomes and also suggest an involvement of myosin VI in this pathway.
18348273 In conclusion, a novel nonsense MYO6 mutation causes post-lingual, slowly progressive autosomal dominant nonsyndromic moderate to severe hearing loss in a Danish family.
18212818 inner ear hair cells are sensitive to changes in expression levels of MYO6
18029400 Myosin VI and LMTK2 are required for the transport of cargo, such as the Transferrin Receptor, from early endosomes to the endocytic recycling compartment.
17683200 Results are consistent with vesicle-associated myosin VI existing as a processive dimer, capable of its known trafficking function.
17635994 results suggest that myosin VI-T6BP-NDP52 complexes may play a role in coordinating cytokine signalling and membrane transport pathways with actin filament organisation and cell adhesion
17187061 We have identified three binding sites in the Myosin VI carboxy-terminal: a WWY motif for Disabled-2, a RRL motif for glucose-transporter binding protein and optineurin binding and a site that binds specifically to PtdIns(4,5)P2-containing liposomes.
17071605 These results support that myosin VI is critical in maintaining the malignant properties of the majority of human prostate cancers diagnosed today.
16949370 Myosin VI modulates RNAPII-dependent transcription of active genes, implicating the possibility of an actin-myosin based mechanism of transcription.
16507995 a novel function for p53 in the maintenance of Golgi complex integrity and for myosin VI in the p53-dependent prosurvival pathway.
15247260 myosin VI and Dab2 facilitate CFTR endocytosis by a mechanism that requires actin filaments
15146066 Inhibiting myosin VI expression in high-grade ovarian carcinoma cells impeded cell spreading and migration in vitro; optical imaging and histopathologic studies revealed that inhibiting myosin VI expression reduces tumor dissemination in nude mice
15123708 Results report the effects of the C442Y mutation on the kinetics of the actomyosin ATP hydrolysis mechanism and motor function of myosin VI.
12687499 In families with recessively inherited deafness, DFNB37, our sequence analyses of MYO6 reveal a frameshift mutation (36-37insT), a nonsense mutation (R1166X), and a missense mutation (E216V)

AA Sequence

MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNE      1 - 70
ATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKV     71 - 140
LKMSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFV    141 - 210
EIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTR    211 - 280
YFANKETDKQILQNRKSPEYLKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNI    281 - 350
DFEEAGSTSGGCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNAR    351 - 420
DALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILK    421 - 490
EEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLTIP    491 - 560
RKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESRDKFIRELFESSTNNNKD    561 - 630
TKQKAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDL    631 - 700
MQGGYPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIM    701 - 770
KSDPDHLAELVKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGL    771 - 840
VKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKSTMMTQEQIQKEYDALVKSSEELL    841 - 910
SALQKKKQQEEEAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKR    911 - 980
IQAEVEAQLARQKEEESQQQAVLEQERRDRELALRIAQSEAELISDEAQADLALRRSLDSYPVSKNDGTR    981 - 1050
PKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKV   1051 - 1120
YHAWKSKNKKRNTETEQRAPKSVTDYDFAPFLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQ   1121 - 1190
YKDPQSKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEE   1191 - 1260
IWERCGGIQYLQNAIESRQARPTYATAMLQSLLK                                       1261 - 1294
//

Text Mined References (94)

PMID Year Title
27018747 2016 Interaction of myosin VI and its binding partner DOCK7 plays an important role in NGF-stimulated protrusion formation in PC12 cells.
26950368 2016 Diverse functions of myosin VI elucidated by an isoform-specific ?-helix domain.
26451915 2015 The Autophagy Receptor TAX1BP1 and the Molecular Motor Myosin VI Are Required for Clearance of Salmonella Typhimurium by Autophagy.
26407123 2015 Lentivirus-Mediated Knockdown of Myosin VI Inhibits Cell Proliferation of Breast Cancer Cell.
26324058 2015 Knockdown of myosin VI by lentivirus-mediated short hairpin RNA suppresses proliferation of melanoma.
26263762 2014 [The role of actin cytoskeleton and myosin VI in clathrin-dependent endocytosis].
25999546 2015 Massively parallel DNA sequencing successfully identified seven families with deafness-associated MYO6 mutations: the mutational spectrum and clinical characteristics.
25859013 2015 Defects in optineurin- and myosin VI-mediated cellular trafficking in amyotrophic lateral sclerosis.
25703929 2015 Knockdown of Myosin VI Inhibits Proliferation of Hepatocellular Carcinoma Cells In Vitro.
25643992 2015 Lentivirus-Mediated Silencing of Myosin VI Inhibits Proliferation and Cell Cycle Progression in Human Lung Cancer Cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25227905 2014 Exome sequencing identifies a novel frameshift mutation of MYO6 as the cause of autosomal dominant nonsyndromic hearing loss in a Chinese family.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
25125183 2014 Myosin VI localization and expression in striated muscle pathology.
25122759 2014 Stable single ?-helices are constant force springs in proteins.
25080041 2014 The effect of novel mutations on the structure and enzymatic activity of unconventional myosins associated with autosomal dominant non-syndromic hearing loss.
24928903 2014 Myosin VI mediates the movement of NHE3 down the microvillus in intestinal epithelial cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105371 2014 Novel myosin mutations for hereditary hearing loss revealed by targeted genomic capture and massively parallel sequencing.
24028494 2013 Myosin VI contributes to maintaining epithelial barrier function.
23635807 2013 A novel MYO6 splice site mutation causes autosomal dominant sensorineural hearing loss type DFNA22 with a favourable outcome after cochlear implantation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23340379 2013 Progressive hereditary hearing impairment caused by a MYO6 mutation resembles presbyacusis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23023224 2012 Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome.
23007415 The juxtamembrane domain of the E-cadherin cytoplasmic tail contributes to its interaction with Myosin VI.
22992744 2012 Dynamic exchange of myosin VI on endocytic structures.
22884421 2012 Kinetic properties and small-molecule inhibition of human myosin-6.
22323290 2012 FCH domain only-2 organizes clathrin-coated structures and interacts with Disabled-2 for low-density lipoprotein receptor endocytosis.
22321127 2012 Myosin VI regulates actin dynamics and melanosome biogenesis.
22171985 2012 How myosin motors power cellular functions: an exciting journey from structure to function: based on a lecture delivered at the 34th FEBS Congress in Prague, Czech Republic, July 2009.
21735821 2011 [Myosin VI: the unique motor protein of the actin cytoskeleton].
21626137 2011 Two-marker association tests yield new disease associations for coronary artery disease and hypertension.
21278381 2011 Role of insert-1 of myosin VI in modulating nucleotide affinity.
21269460 2011 Initial characterization of the human central proteome.
21148290 2011 Myosin VI and its binding partner optineurin are involved in secretory vesicle fusion at the plasma membrane.
20850010 2010 Switch between large hand-over-hand and small inchworm-like steps in myosin VI.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20604900 2010 Myosin VI and optineurin are required for polarized EGFR delivery and directed migration.
20576604 2010 Myosin VI is differentially regulated by DNA damage in p53- and cell type-dependent manners.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20353999 2010 The microRNA profile of prostate carcinoma obtained by deep sequencing.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19893302 2010 Genotype-phenotype correlation for DFNA22: characterization of non-syndromic, autosomal dominant, progressive sensorineural hearing loss due to MYO6 mutations.
19855435 2010 Overexpression of myosin VI in prostate cancer cells enhances PSA and VEGF secretion, but has no effect on endocytosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18543251 2008 GOLPH2 and MYO6: putative prostate cancer markers localized to the Golgi apparatus.
18511944 2008 Long single alpha-helical tail domains bridge the gap between structure and function of myosin VI.
18429820 2008 BREK/LMTK2 is a myosin VI-binding protein involved in endosomal membrane trafficking.
18348273 2008 A novel nonsense mutation in MYO6 is associated with progressive nonsyndromic hearing loss in a Danish DFNA22 family.
18311135 2008 Motor protein-dependent transport of AMPA receptors into spines during long-term potentiation.
18212818 2008 A splice-site mutation and overexpression of MYO6 cause a similar phenotype in two families with autosomal dominant hearing loss.
18029400 2007 Myosin VI and its interacting protein LMTK2 regulate tubule formation and transport to the endocytic recycling compartment.
17683200 2007 Precise positioning of myosin VI on endocytic vesicles in vivo.
17635994 2007 T6BP and NDP52 are myosin VI binding partners with potential roles in cytokine signalling and cell adhesion.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17187061 2007 Myosin VI targeting to clathrin-coated structures and dimerization is mediated by binding to Disabled-2 and PtdIns(4,5)P2.
17071605 2006 A novel role of myosin VI in human prostate cancer.
16949370 2006 Nuclear myosin VI enhances RNA polymerase II-dependent transcription.
16948370 Clinical evaluation of atraumatic restorations in primary molars: a comparison between 2 glass ionomer cements.
16908842 2006 Binding of internalized receptors to the PDZ domain of GIPC/synectin recruits myosin VI to endocytic vesicles.
16507995 2006 Myosin VI is a mediator of the p53-dependent cell survival pathway.
16499958 2006 Crystal structure of the ubiquitin binding domains of rabex-5 reveals two modes of interaction with ubiquitin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15837803 2005 Optineurin links myosin VI to the Golgi complex and is involved in Golgi organization and exocytosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15247260 2004 Myosin VI regulates endocytosis of the cystic fibrosis transmembrane conductance regulator.
15146066 2004 Lessons from border cell migration in the Drosophila ovary: A role for myosin VI in dissemination of human ovarian cancer.
15123708 2004 Human deafness mutation of myosin VI (C442Y) accelerates the ADP dissociation rate.
15060111 2004 Novel association of hypertrophic cardiomyopathy, sensorineural deafness, and a mutation in unconventional myosin VI (MYO6).
15044955 2004 A monomeric myosin VI with a large working stroke.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12893809 2003 Myosin VI: two distinct roles in endocytosis.
12857860 2003 Myo6 facilitates the translocation of endocytic vesicles from cell peripheries.
12687499 2003 Mutations of MYO6 are associated with recessive deafness, DFNB37.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12050163 2002 Interaction of SAP97 with minus-end-directed actin motor myosin VI. Implications for AMPA receptor trafficking.
11967127 2002 Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton.
11906161 2002 DOC-2/DAB2 is the binding partner of myosin VI.
11728438 2001 Myosin VI, a new force in clathrin mediated endocytosis.
11707568 2001 Myosin VI is a processive motor with a large step size.
11517222 2001 Dual regulation of mammalian myosin VI motor function.
11468689 2001 MYO6, the human homologue of the gene responsible for deafness in Snell's waltzer mice, is mutated in autosomal dominant nonsyndromic hearing loss.
11447109 2001 Myosin VI isoform localized to clathrin-coated vesicles with a role in clathrin-mediated endocytosis.
10519557 1999 Myosin VI is an actin-based motor that moves backwards.
9852149 1998 The localization of myosin VI at the golgi complex and leading edge of fibroblasts and its phosphorylation and recruitment into membrane ruffles of A431 cells after growth factor stimulation.
9259267 1997 Characterization of unconventional MYO6, the human homologue of the gene responsible for deafness in Snell's waltzer mice.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8022818 1994 Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types.
7929586 1994 Porcine myosin-VI: characterization of a new mammalian unconventional myosin.
7493015 1995 The mouse Snell's waltzer deafness gene encodes an unconventional myosin required for structural integrity of inner ear hair cells.