Property Summary

NCBI Gene PubMed Count 23
PubMed Score 20.19
PubTator Score 23.51

Knowledge Summary

Patent (1,277)

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6685 3.5e-63
ependymoma 2514 1.6e-06
osteosarcoma 7933 4.4e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Nonsyndromic deafness 121 4.79 2.4
Disease Target Count Z-score Confidence
Hodgkin's lymphoma, nodular sclerosis 24 3.199 1.6
Disease Target Count
Deafness, autosomal recessive, 30 1

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.178 4.4e-02
ependymoma 2.200 1.6e-06
psoriasis -2.600 3.5e-63

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (13)

PMID Text
25402663 Data suggest that, in enterocytes, MYO3A autophosphorylation of kinase domain at Thr184/Thr188 regulates kinase activity, translocation of MYO3A to tips of microvilli, and stability of actin cytoskeleton.
24214986 The differential regulation of the kinase and motor activities allows for MYO3A to precisely self-regulate its concentration in the actin bundle-based structures of cells.
20826793 Results suggest that Myo3A motor activity is regulated through a mechanism involving concentration-dependent autophosphorylation.
20610541 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20090771 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19229853 behavioral inhibition-associated SNPs appear to be associated with differences in MYO3A- but not GAD2 lymphoblastoid-mRNA expression levels
19229853 Observational study of gene-disease association. (HuGE Navigator)
18229949 A model in which the activity and concentration of myosin IIIA localized to the tips of actin bundles mediates the morphology of the tips in sensory cells.
17074769 the actomyosin-ADP state may be important for the ability of myosin III to function as a cellular transporter and actin cross-linker in the actin bundles of sensory cells
17012748 myosin IIIA can spend a majority of its ATP hydrolysis cycling time on actin
16385451 Observational study of gene-disease association. (HuGE Navigator)
12672820 class III myosin is an actin-based motor protein having a protein kinase activity
12032315 mutation in humans causes progressive nonsyndromic hearing loss DFNB30

AA Sequence

MFPLIGKTIIFDNFPDPSDTWEITETIGKGTYGKVFKVLNKKNGQKAAVKILDPIHDIDEEIEAEYNILK      1 - 70
ALSDHPNVVRFYGIYFKKDKVNGDKLWLVLELCSGGSVTDLVKGFLKRGERMSEPLIAYILHEALMGLQH     71 - 140
LHNNKTIHRDVKGNNILLTTEGGVKLVDFGVSAQLTSTRHRRNTSVGTPFWMAPEVIACEQQLDTTYDAR    141 - 210
CDTWSLGITAIELGDGDPPLADLHPMRALFKIPRNPPPKLRQPELWSAEFNDFISKCLTKDYEKRPTVSE    211 - 280
LLQHKFITQIEGKDVMLQKQLTEFIGIHQCMGGTEKARRERIHTKKGNFNRPLISNLKDVDDLATLEILD    281 - 350
ENTVSEQLEKCYSRDQIYVYVGDILIALNPFQSLGLYSTKHSKLYIGSKRTASPPHIFAMADLGYQSMIT    351 - 420
YNSDQCIVISGESGAGKTENAHLLVQQLTVLGKANNRTLQEKILQVNNLVEAFGNACTIINDNSSRFGKY    421 - 490
LEMKFTSSGAVVGAQISEYLLEKSRVIHQAIGEKNFHIFYYIYAGLAEKKKLAHYKLPENKPPRYLQNDH    491 - 560
LRTVQDIMNNSFYKSQYELIEQCFKVIGFTMEQLGSIYSILAAILNVGNIEFSSVATEHQIDKSHISNHT    561 - 630
ALENCASLLCIRADELQEALTSHCVVTRGETIIRPNTVEKATDVRDAMAKTLYGRLFSWIVNCINSLLKH    631 - 700
DSSPSGNGDELSIGILDIFGFENFKKNSFEQLCINIANEQIQYYYNQHVFAWEQNEYLNEDVDARVIEYE    701 - 770
DNWPLLDMFLQKPMGLLSLLDEESRFPKATDQTLVEKFEGNLKSQYFWRPKRMELSFGIHHYAGKVLYNA    771 - 840
SGFLAKNRDTLPTDIVLLLRSSDNSVIRQLVNHPLTKTGNLPHSKTKNVINYQMRTSEKLINLAKGDTGE    841 - 910
ATRHARETTNMKTQTVASYFRYSLMDLLSKMVVGQPHFVRCIKPNSERQARKYDKEKVLLQLRYTGILET    911 - 980
ARIRRLGFSHRILFANFIKRYYLLCYKSSEEPRMSPDTCATILEKAGLDNWALGKTKVFLKYYHVEQLNL    981 - 1050
MRKEAIDKLILIQACVRAFLCSRRYQKIQEKRKESAIIIQSAARGHLVRKQRKEIVDMKNTAVTTIQTSD   1051 - 1120
QEFDYKKNFENTRESFVKKQAENAISANERFISAPNNKGSVSVVKTSTFKPEEETTNAVESNNRVYQTPK   1121 - 1190
KMNNVYEEEVKQEFYLVGPEVSPKQKSVKDLEENSNLRKVEKEEAMIQSYYQRYTEERNCEESKAAYLER   1191 - 1260
KAISERPSYPVPWLAENETSFKKTLEPTLSQRSIYQNANSMEKEKKTSVVTQRAPICSQEEGRGRLRHET   1261 - 1330
VKERQVEPVTQAQEEEDKAAVFIQSKYRGYKRRQQLRKDKMSSFKHQRIVTTPTEVARNTHNLYSYPTKH   1331 - 1400
EEINNIKKKDNKDSKATSEREACGLAIFSKQISKLSEEYFILQKKLNEMILSQQLKSLYLGVSHHKPINR   1401 - 1470
RVSSQQCLSGVCKGEEPKILRPPRRPRKPKTLNNPEDSTYYYLLHKSIQEEKRRPRKDSQGKLLDLEDFY   1471 - 1540
YKEFLPSRSGPKEHSPSLRERRPQQELQNQCIKANERCWAAESPEKEEEREPAANPYDFRRLLRKTSQRR   1541 - 1610
RLVQQS                                                                   1611 - 1616
//

Text Mined References (24)

PMID Year Title
25402663 2014 Phosphorylation of the kinase domain regulates autophosphorylation of myosin IIIA and its translocation in microvilli.
24214986 2013 Myosin 3A kinase activity is regulated by phosphorylation of the kinase domain activation loop.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20826793 2010 Intermolecular autophosphorylation regulates myosin IIIa activity and localization in parallel actin bundles.
20610541 2010 Genome-wide association study for colorectal cancer identifies risk polymorphisms in German familial cases and implicates MAPK signalling pathways in disease susceptibility.
20090771 2010 Supervised machine learning and logistic regression identifies novel epistatic risk factors with PTPN22 for rheumatoid arthritis.
19229853 2009 Polymorphisms in the GAD2 gene-region are associated with susceptibility for unipolar depression and with a risk factor for anxiety disorders.
18229949 2008 The kinase domain alters the kinetic properties of the myosin IIIA motor.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17074769 2007 Kinetic mechanism of human myosin IIIA.
17021180 2006 A new compartment at stereocilia tips defined by spatial and temporal patterns of myosin IIIa expression.
17012748 2006 Human myosin III is a motor having an extremely high affinity for actin.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12672820 2003 Determination of human myosin III as a motor protein having a protein kinase activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12032315 2002 From flies' eyes to our ears: mutations in a human class III myosin cause progressive nonsyndromic hearing loss DFNB30.
10936054 2000 Cloning and chromosomal localization of a human class III myosin.
1262820 1976 Irradiation inhibits the regeneration of aneurogenic limbs.