Property Summary

NCBI Gene PubMed Count 21
PubMed Score 51.21
PubTator Score 20.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -3.400 2.1e-08
psoriasis 1.200 1.9e-08
osteosarcoma 1.124 2.9e-04
posterior fossa group B ependymoma 1.700 2.9e-09
atypical teratoid / rhabdoid tumor 1.400 1.6e-04
glioblastoma 1.500 1.1e-03
pediatric high grade glioma 1.100 2.7e-03
lung carcinoma -1.100 2.7e-14

Gene RIF (9)

PMID Text
25739341 Coinheritance of COL4A5 and MYO1E mutations accentuate the severity of kidney disease.
24750828 MYO1E mutations are not a major cause of Chinese familial Steroid-resistant nephrotic syndrome.
23977349 Myo1e is a key component contributing to the functional integrity of podocytes.
21756023 MYO1E mutations are associated with childhood-onset, glucocorticoid-resistant focal segmental glomerulosclerosis.
21697813 Homozygosity mapping and exome sequencing in a consanguineous kindred identified MYO1E and NEIL1 as novel candidate genes for human autosomal recessive steroid-resistant nephrotic syndrome.
20860408 myo1e binds lipids through nonspecific electrostatic interactions rather than a stereospecific protein-phosphoinositide interaction.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17257598 Two proteins with prominent functions in endocytosis, synaptojanin-1 and dynamin, bind to the SH3 domain of human Myo1E.
11940582 The kinetic mechanism of Myo1e (human myosin-IC).

AA Sequence

MGSKGVYQYHWQSHNVKHSGVDDMVLLSKITENSIVENLKKRYMDDYIFTYIGSVLISVNPFKQMPYFGE      1 - 70
KEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYISRVSGGGTKVQ     71 - 140
HVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFH    141 - 210
IFYQLIEGASAEQKHSLGITSMDYYYYLSLSGSYKVDDIDDRREFQETLHAMNVIGIFAEEQTLVLQIVA    211 - 280
GILHLGNISFKEVGNYAAVESEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACY    281 - 350
TRDALAKALHARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELT    351 - 420
LKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGIMSILDDVCATMHAVGEGADQTLLQKLQMQIG    421 - 490
SHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELPFIKSLFPENLQADKKGRPTT    491 - 560
AGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPRDWEESRVKHQVEYLGLKENIRVRRAGYAYRRIFQ    561 - 630
KFLQRYAILTKATWPSWQGEEKQGVLHLLQSVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYAR    631 - 700
VIQKSWRKFVARKKYVQMREEASDLLLNKKERRRNSINRNFIGDYIGMEEHPELQQFVGKREKIDFADTV    701 - 770
TKYDRRFKGVKRDLLLTPKCLYLIGREKVKQGPDKGLVKEVLKRKIEIERILSVSLSTMQDDIFILHEQE    771 - 840
YDSLLESVFKTEFLSLLAKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQFHQGFGDLAVLK    841 - 910
PSNKVLQVSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQNGVIRNQYVPYPHAPGS    911 - 980
QRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSRPPPAGGRPKPQPKPK    981 - 1050
PQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLRGKQGLFPNNYVTKI               1051 - 1108
//

Text Mined References (27)

PMID Year Title
25739341 2015 Coinheritance of COL4A5 and MYO1E mutations accentuate the severity of kidney disease.
24750828 2014 [Mutational analysis of MYO1E in Chinese children with familial steroid-resistant nephrotic syndrome].
24047820 2013 Common variation contributes to the genetic architecture of social communication traits.
23977349 2013 Myo1e impairment results in actin reorganization, podocyte dysfunction, and proteinuria in zebrafish and cultured podocytes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
21756023 2011 MYO1E mutations and childhood familial focal segmental glomerulosclerosis.
21697813 2011 Exome sequencing identified MYO1E and NEIL1 as candidate genes for human autosomal recessive steroid-resistant nephrotic syndrome.
21458045 2011 A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation.
21269460 2011 Initial characterization of the human central proteome.
20860408 2010 Myo1e binds anionic phospholipids with high affinity.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19846667 2009 Distinct roles for CARMIL isoforms in cell migration.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17257598 2007 Myosin 1E interacts with synaptojanin-1 and dynamin and is involved in endocytosis.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11940582 2002 The kinetic mechanism of Myo1e (human myosin-IC).
9858156 1998 Human brush border myosin-I and myosin-Ic expression in human intestine and Caco-2BBe cells.
9367879 1997 A c-Cbl yeast two hybrid screen reveals interactions with 14-3-3 isoforms and cytoskeletal components.
8884266 1996 Mapping of unconventional myosins in mouse and human.
8022818 1994 Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types.
7972138 1994 Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types.
7932763 1994 Cloning and mRNA expression of human unconventional myosin-IC. A homologue of amoeboid myosins-I with a single IQ motif and an SH3 domain.