Property Summary

NCBI Gene PubMed Count 19
PubMed Score 22.15
PubTator Score 9.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -3.400 3.2e-08
cystic fibrosis 2.530 7.0e-07
intraductal papillary-mucinous carcinoma... 1.300 2.5e-02
lung cancer 1.100 1.5e-03
pediatric high grade glioma -1.100 1.8e-02
pilocytic astrocytoma -1.100 7.9e-03
nasopharyngeal carcinoma -1.200 2.7e-04
lung adenocarcinoma 1.207 3.0e-04
gastric carcinoma 1.300 1.6e-02
mucosa-associated lymphoid tissue lympho... 1.212 8.6e-03
ulcerative colitis -1.900 2.5e-07
ovarian cancer -1.700 5.9e-11

Gene RIF (5)

PMID Text
25006744 Top single-nucleotide polymorphism rs379123 in MYO1D is located within genes that function in cell-cell signaling and cell migration.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
17376794 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGRDTIEQYKGRE      1 - 70
LYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLK     71 - 140
SNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQG    141 - 210
GSEQMLRSLHLQKSLSSYNYIHVGAQLKSSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNL    211 - 280
KFVVDGDTPLIENGKVVSIIAELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYER    281 - 350
LFCWIVTRINDIIEVKNYDTTIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQ    351 - 420
EEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLGKHAHFSSRKL    421 - 490
CASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSNPVLKNMWPEGKLSITEVTKR    491 - 560
PLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQ    561 - 630
TYEKFLHRYKMISEFTWPNHDLPSDKEAVKKLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIR    631 - 700
IVLFLQKVWRGTLARMRYKRTKAALTIIRYYRRYKVKSYIHEVARRFHGVKTMRDYGKHVKWPSPPKVLR    701 - 770
RFEEALQTIFNRWRASQLIKSIPASDLPQVRAKVAAVEMLKGQRADLGLQRAWEGNYLASKPDTPQTSGT    771 - 840
FVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKTIPLYNLTGLSVS    841 - 910
NGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSEKRHLQVNVTNPVQCSLHGKKCTVS    911 - 980
VETRLNQPQPDFTKNRSGFILSVPGN                                                981 - 1006
//

Text Mined References (21)

PMID Year Title
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22322875 2012 Genetic association of short sleep duration with hypertension incidence--a 6-year follow-up in the Korean genome and epidemiology study.
22284616 2012 Expression and localization of myosin-1d in the developing nervous system.
21269460 2011 Initial characterization of the human central proteome.
20686608 2010 Genome-wide association study of pancreatic cancer in Japanese population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17376794 2007 High density SNP association study of a major autism linkage region on chromosome 17.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8884266 1996 Mapping of unconventional myosins in mouse and human.