Property Summary

NCBI Gene PubMed Count 41
PubMed Score 76.36
PubTator Score 67.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 1.700 4.9e-03
ependymoma 1.800 5.6e-03
oligodendroglioma 1.800 2.7e-03
osteosarcoma 2.386 9.9e-06
atypical teratoid / rhabdoid tumor 1.200 1.2e-03
pancreatic ductal adenocarcinoma liver m... 1.202 2.2e-02
non-small cell lung cancer -1.001 1.8e-12
breast carcinoma -1.100 5.7e-04
lung carcinoma -1.500 4.1e-17
mucosa-associated lymphoid tissue lympho... 1.142 8.8e-03
ductal carcinoma in situ -1.100 4.5e-03
invasive ductal carcinoma -1.400 7.0e-03
ovarian cancer -1.200 1.2e-04

Gene RIF (17)

PMID Text
25660542 Myo1c significantly increases the frequency of kinesin-1-driven microtubule-based runs that begin at actin/microtubule intersections. The actin-binding protein tropomyosin 2 abolishes Myo1c-specific effects on both run initiation and run termination.
25551774 Ablating MYO1C function causes abnormal cholesterol distribution, which has a major selective impact on the autophagy pathway
24901984 NM1 phosphorylation by GSK3beta blocks NM1 ubiquitination by UBR5 and degradation by the proteasome, leads to NM1 association with the chromatin and promotes rDNA transcription activation at G1.
24698832 The relationship between MYO1C and KAT6B suggests that the two are interacting in chromatin remodelling for gene expression in human masseter muscle. This is the nuclear myosin1 (NM1) function of MYO1C.
24636949 The structural context and the chemical environment of Myo1c mutations that are involved in sensorineural hearing loss in humans are described and their impact on motor function is discussed.
24523293 myosin 1c manipulations lead to loss of the actin filaments and to similar endoplasmic reticulum phenotype as observed after actin depolymerization.
23555303 These results suggest a unique structural role for NM1 in which the interaction with SNF2h stabilizes B-WICH at the gene promoter and facilitates recruitment of the HAT PCAF
23438938 Both nucleolar localization signals are functional and necessary for nucleolar localization of specifically myosin IC isoform B.
23262137 This is the first report demonstrating that Myo1c is an important mediator of VEGF-induced VEGFR2 delivery to the cell surface and plays a role in angiogenic signaling.
22328521 Myo1c regulates lipid raft recycling to control cell spreading, migration and Salmonella invasion.
21402783 Myo1c plays a critical role in the translocation of Neph1 complexes in podocytes. Myo1c's ability to interact with membranes, F-actin, Neph1, and nephrin indicates that it actively contributes to the dynamic organization of the filtration slit.
19729515 NM1 facilitates maturation and accompanies export-competent preribosomal subunits to the nuclear pore complex, thus modulating export.
19027848 identification of 6 heterozygous missense mutations in MYO1C and additional 5 heterozygous missense mutations in MYO1F in bilateral sensorineural hearing loss
19027848 Observational study of gene-disease association. (HuGE Navigator)
18599791 Sensing molecular tension is crucial for a wide array of cellular processes. Myosin I dramatically alters its motile properties in response to tension.
16603771 WSTF-SNF2h-NM1 forms a platform in transcription while providing chromatin remodeling
16514417 NM1 cooperates with a chromatin remodelling complex containing WSTF (Williams syndrome transcription factor) and SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily A member 5 protein (SNF2h).

AA Sequence

MALQVELVPTGEIIRVVHPHRPCKLALGSDGVRVTMESALTARDRVGVQDFVLLENFTSEAAFIENLRRR      1 - 70
FRENLIYTYIGPVLVSVNPYRDLQIYSRQHMERYRGVSFYEVPPHLFAVADTVYRALRTERRDQAVMISG     71 - 140
ESGAGKTEATKRLLQFYAETCPAPERGGAVRDRLLQSNPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKG    141 - 210
APVGGHILSYLLEKSRVVHQNHGERNFHIFYQLLEGGEEETLRRLGLERNPQSYLYLVKGQCAKVSSIND    211 - 280
KSDWKVVRKALTVIDFTEDEVEDLLSIVASVLHLGNIHFAANEESNAQVTTENQLKYLTRLLSVEGSTLR    281 - 350
EALTHRKIIAKGEELLSPLNLEQAAYARDALAKAVYSRTFTWLVGKINRSLASKDVESPSWRSTTVLGLL    351 - 420
DIYGFEVFQHNSFEQFCINYCNEKLQQLFIELTLKSEQEEYEAEGIAWEPVQYFNNKIICDLVEEKFKGI    421 - 490
ISILDEECLRPGEATDLTFLEKLEDTVKHHPHFLTHKLADQRTRKSLGRGEFRLLHYAGEVTYSVTGFLD    491 - 560
KNNDLLFRNLKETMCSSKNPIMSQCFDRSELSDKKRPETVATQFKMSLLQLVEILQSKEPAYVRCIKPND    561 - 630
AKQPGRFDEVLIRHQVKYLGLLENLRVRRAGFAYRRKYEAFLQRYKSLCPETWPTWAGRPQDGVAVLVRH    631 - 700
LGYKPEEYKMGRTKIFIRFPKTLFATEDALEVRRQSLATKIQAAWRGFHWRQKFLRVKRSAICIQSWWRG    701 - 770
TLGRRKAAKRKWAAQTIRRLIRGFVLRHAPRCPENAFFLDHVRTSFLLNLRRQLPQNVLDTSWPTPPPAL    771 - 840
REASELLRELCIKNMVWKYCRSISPEWKQQLQQKAVASEIFKGKKDNYPQSVPRLFISTRLGTDEISPRV    841 - 910
LQALGSEPIQYAVPVVKYDRKGYKPRSRQLLLTPNAVVIVEDAKVKQRIDYANLTGISVSSLSDSLFVLH    911 - 980
VQRADNKQKGDVVLQSDHVIETLTKTALSANRVNSININQGSITFAGGPGRDGTIDFTPGSELLITKAKN    981 - 1050
GHLAVVAPRLNSR                                                            1051 - 1063
//

Text Mined References (52)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25660542 2015 Control of the initiation and termination of kinesin-1-driven transport by myosin-Ic and nonmuscle tropomyosin.
25551774 2014 Loss of functional MYO1C/myosin 1c, a motor protein involved in lipid raft trafficking, disrupts autophagosome-lysosome fusion.
24901984 2014 Glycogen synthase kinase (GSK) 3? phosphorylates and protects nuclear myosin 1c from proteasome-mediated degradation to activate rDNA transcription in early G1 cells.
24698832 2014 Molecular motor MYO1C, acetyltransferase KAT6B and osteogenetic transcription factor RUNX2 expression in human masseter muscle contributes to development of malocclusion.
24636949 2014 Crystal structure of human myosin 1c--the motor in GLUT4 exocytosis: implications for Ca2+ regulation and 14-3-3 binding.
24523293 2014 ER sheet persistence is coupled to myosin 1c-regulated dynamic actin filament arrays.
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23555303 2013 Nuclear myosin 1c facilitates the chromatin modifications required to activate rRNA gene transcription and cell cycle progression.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23438938 2013 Identification of signals that facilitate isoform specific nucleolar localization of myosin IC.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23262137 2013 The myosin motor Myo1c is required for VEGFR2 delivery to the cell surface and for angiogenic signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22736583 2012 Identification and characterization of a novel myosin Ic isoform that localizes to the nucleus.
22328521 2012 Myo1c regulates lipid raft recycling to control cell spreading, migration and Salmonella invasion.
21402783 2011 Motor protein Myo1c is a podocyte protein that facilitates the transport of slit diaphragm protein Neph1 to the podocyte membrane.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19729515 2010 Nuclear myosin 1 is in complex with mature rRNA transcripts and associates with the nuclear pore basket.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19027848 2009 Are MYO1C and MYO1F associated with hearing loss?
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18599791 2008 Myosin I can act as a molecular force sensor.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16960872 2006 Nuclear myosin I is necessary for the formation of the first phosphodiester bond during transcription initiation by RNA polymerase II.
16957816 2007 Nuclear myosin is ubiquitously expressed and evolutionary conserved in vertebrates.
16877530 2006 Small ribosomal subunits associate with nuclear myosin and actin in transit to the nuclear pores.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16603771 2006 The WSTF-SNF2h chromatin remodeling complex interacts with several nuclear proteins in transcription.
16514417 2006 The chromatin remodelling complex WSTF-SNF2h interacts with nuclear myosin 1 and has a role in RNA polymerase I transcription.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16133118 2005 Nuclear distribution of actin and myosin I depends on transcriptional activity of the cell.
15558034 2004 Nuclear actin and myosin I are required for RNA polymerase I transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11030652 2000 A myosin I isoform in the nucleus.
9119401 1997 Cloning of the genes encoding two murine and human cochlear unconventional type I myosins.
8884266 1996 Mapping of unconventional myosins in mouse and human.
8719884 1995 Localization of the rat myosin I molecules myr 1 and myr 2 and in vivo targeting of their tail domains.