Property Summary

NCBI Gene PubMed Count 22
PubMed Score 58.04
PubTator Score 55.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 1.100 2.5e-04
astrocytic glioma -1.200 1.4e-02
psoriasis 2.000 3.7e-04
osteosarcoma 3.742 8.8e-05
sonic hedgehog group medulloblastoma 2.400 2.4e-05
medulloblastoma, large-cell 1.600 1.1e-03
primitive neuroectodermal tumor 1.600 8.7e-03
pancreatic ductal adenocarcinoma liver m... -2.134 1.7e-03
non-small cell lung cancer -1.005 2.9e-13
intraductal papillary-mucinous adenoma (... -1.400 1.2e-02
diabetes mellitus -1.100 1.9e-02
pediatric high grade glioma 1.100 2.5e-02
subependymal giant cell astrocytoma 1.997 2.3e-02
lung adenocarcinoma -1.200 9.5e-08
lung carcinoma -1.200 1.3e-10
ulcerative colitis 1.100 1.7e-05
ovarian cancer 2.400 6.8e-06

Gene RIF (8)

PMID Text
26545583 the overexpression of miR-363 reduces cellular migration in head and neck cancer and reveal the biological relationship between miR-363, myosin 1b, and HPV-positive SCCHN.
26195670 Myosin 1 functions as an effector of EphB2/ephrinB signaling, controls cell morphology, and thereby cell repulsion.
25421751 Results showed that aberrant overexpression of Myo1b in human head and neck squamous cell carcinoma increased cancer cell motility via enhanced large protrusion formation of cell membrane and promotes lymph node metastasis.
24709651 Myosin 1b catch-bond properties facilitate tube extraction under conditions of increasing membrane tension by reducing the density of myo1b required to pull tubes.
21666684 Actin and myosin 1 regulate organelle shape and uncover an important function for myosin 1b in the initiation of post-Golgi carrier formation by regulating actin assembly and remodelling trans-Golgi network membranes.
18599791 Sensing molecular tension is crucial for a wide array of cellular processes. Myosin I dramatically alters its motile properties in response to tension.
16219689 observations suggest that myosin 1b controls the traffic of protein cargo in multivesicular endosomes most probably through its ability to modulate with actin the morphology of these sorting endosomes
12486594 At apical surfaces of supporting cells that surround hair cells in auditory epithelia of postnatal rats. In vestibular epithelia, present in ring within apical pole of hair cell. Expression was prominent only immediately after birth.

AA Sequence

MAKMEVKTSLLDNMIGVGDMVLLEPLNEETFINNLKKRFDHSEIYTYIGSVVISVNPYRSLPIYSPEKVE      1 - 70
EYRNRNFYELSPHIFALSDEAYRSLRDQDKDQCILITGESGAGKTEASKLVMSYVAAVCGKGAEVNQVKE     71 - 140
QLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQ    141 - 210
LLSGASEELLNKLKLERDFSRYNYLSLDSAKVNGVDDAANFRTVRNAMQIVGFMDHEAESVLAVVAAVLK    211 - 280
LGNIEFKPESRVNGLDESKIKDKNELKEICELTGIDQSVLERAFSFRTVEAKQEKVSTTLNVAQAYYARD    281 - 350
ALAKNLYSRLFSWLVNRINESIKAQTKVRKKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTL    351 - 420
KEEQEEYIREDIEWTHIDYFNNAIICDLIENNTNGILAMLDEECLRPGTVTDETFLEKLNQVCATHQHFE    421 - 490
SRMSKCSRFLNDTSLPHSCFRIQHYAGKVLYQVEGFVDKNNDLLYRDLSQAMWKASHALIKSLFPEGNPA    491 - 560
KINLKRPPTAGSQFKASVATLMKNLQTKNPNYIRCIKPNDKKAAHIFNEALVCHQIRYLGLLENVRVRRA    561 - 630
GYAFRQAYEPCLERYKMLCKQTWPHWKGPARSGVEVLFNELEIPVEEYSFGRSKIFIRNPRTLFKLEDLR    631 - 700
KQRLEDLATLIQKIYRGWKCRTHFLLMKKSQIVIAAWYRRYAQQKRYQQTKSSALVIQSYIRGWKARKIL    701 - 770
RELKHQKRCKEAVTTIAAYWHGTQARRELRRLKEEARNKHAIAVIWAYWLGSKARRELKRLKEEARRKHA    771 - 840
VAVIWAYWLGLKVRREYRKFFRANAGKKIYEFTLQRIVQKYFLEMKNKMPSLSPIDKNWPSRPYLFLDST    841 - 910
HKELKRIFHLWRCKKYRDQFTDQQKLIYEEKLEASELFKDKKALYPSSVGQPFQGAYLEINKNPKYKKLK    911 - 980
DAIEEKIIIAEVVNKINRANGKSTSRIFLLTNNNLLLADQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVH    981 - 1050
LKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSV   1051 - 1120
PTCKRKNNRLLEVAVP                                                         1121 - 1136
//

Text Mined References (28)

PMID Year Title
26545583 2015 MicroRNA-363 targets myosin 1B to reduce cellular migration in head and neck cancer.
26195670 2015 Myosin 1b functions as an effector of EphB signaling to control cell repulsion.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25421751 2015 Aberrant Myosin 1b Expression Promotes Cell Migration and Lymph Node Metastasis of HNSCC.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24709651 2014 Catch-bond behaviour facilitates membrane tubulation by non-processive myosin 1b.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21666684 2011 Myosin 1b promotes the formation of post-Golgi carriers by regulating actin assembly and membrane remodelling at the trans-Golgi network.
21269460 2011 Initial characterization of the human central proteome.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18599791 2008 Myosin I can act as a molecular force sensor.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16219689 2005 Myosin Ib modulates the morphology and the protein transport within multi-vesicular sorting endosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12486594 2002 Myosin-I isozymes in neonatal rodent auditory and vestibular epithelia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11509238 2001 Motor domain-dependent localization of myo1b (myr-1).
8719884 1995 Localization of the rat myosin I molecules myr 1 and myr 2 and in vivo targeting of their tail domains.
8449985 1993 Identification, characterization and cloning of myr 1, a mammalian myosin-I.
8022818 1994 Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types.