Property Summary

NCBI Gene PubMed Count 18
PubMed Score 16.89
PubTator Score 16.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Mesothelioma 40
Disease Target Count P-value
diabetes mellitus 1663 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Gout 93 0.0 1.0
Schizophrenia 503 0.0 1.0
Disease Target Count Z-score Confidence
Nemaline myopathy 17 3.866 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.400 1.4e-03

Gene RIF (10)

PMID Text
25778778 No associations were found between rs133885 in myosin-18B and mathematical abilities among individuals with dyslexia or in the general population.
25748484 Deficiency of MYO18B is linked to a novel developmental disorder which combines KFA with myopathy.
23423138 A common MYO18B variant is associated with mathematical disability in children with dyslexia and with intraparietal sulcus variability in neurotypical adults.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17294804 The restored expression of MYO18B may be a useful therapeutic strategy for the treatment of locally advanced Malignant pleural mesothelioma(MPM)in humans.
16499872 Proteasome dysfunction by a proteasome inhibitor or siRNA-mediated knock-down of Sug1 caused the up-regulation of MYO18B protein and MYO18B was polyubiquitinated in vivo.
15305387 MYO18B alterations, including both epigenetic and genetic alterations, play an important role in ovarian carcinogenesis
12547197 Human MYO18B, a novel unconventional myosin heavy chain expressed in striated muscles moves into the myonuclei upon differentiation
12209013 candidate tumor suppressor gene at chromosome 22q12.1, deleted, mutated, and methylated in human lung cancer

AA Sequence

MAISSRLALWEQKIREEDKSPPPSSPPPLFSVIPGGFIKQLVRGTEKEAKEARQRKQLAVASPEREIPEI      1 - 70
SISQPNSKSSSGTRSGSQQISQDDQSSSPGSSDILGKESEGSRSPDPEQMTSINGEKAQELGSSATPTKK     71 - 140
TVPFKRGVRRGDVLLMVAKLDPDSAKPEKTHPHDAPPCKTSPPATDTGKEKKGETSRTPCGSQASTEILA    141 - 210
PKAEKTRTGGLGDPGQGTVALKKGEEGQSIVGKGLGTPKTTELKEAEPQGKDRQGTRPQAQGPGEGVRPG    211 - 280
KAEKEGAEPTNTVEKGNVSKDVGSEGKHVRPQIPGRKWGGFLGRRSKWDGPQNKKDKEGVLLSKAEKTGE    281 - 350
PQTQMEKTSQVQGELGDDLRMGEKAGELRSTTGKAGESWDKKEKMGQPQGKSGNAGEARSQTEKGCEAPK    351 - 420
EVSTMVESPAAPGKGGWPGSRGQEAEEPCSRAGDGAGALETELEGPSQPALEKDAERPRIRKENQDGPAP    421 - 490
QEEGKGGQSRDSDQAPEDRWYEAEKVWLAQKDGFTLATVLKPDEGTADLPAGRVRLWIDADKTITEVDEE    491 - 560
HVHRANPPELDQVEDLASLISVNESSVLNTLLQRYKAQLLHTCTGPDLIVLQPRGPSVPSAGKVPKGRRD    561 - 630
GLPAHIGSMAQRAYWALLNQRRDQSIVALGRSGAGKTTCCEQVLEHLVGMAGSVDGRVSVEKIRATFTVL    631 - 700
RAFGSVSMAHSRSATRFSMVMSLDFNATGRITAAQLQTMLLEKSRVARQPEGESNFLVFSQMLAGLDLDL    701 - 770
RTELNLHQMADSSSFGMGVWSKPEDKQKAAAAFAQLQGAMEMLGISESEQRAVWRVLAAIYHLGAAGACK    771 - 840
VGRKQFMRFEWANYAAEALGCEYEELNTATFKHHLRQIIQQMTFGPSRWGLEDEETSSGLKMTGVDCVEG    841 - 910
MASGLYQELFAAVVSLINRSFSSHHLSMASIMVVDSPGFQNPRHQGKDRAATFEELCHNYAHERLQLLFY    911 - 980
QRTFVSTLQRYQEEGVPVQFDLPDPSPGTTVAVVDQNPSQVRLPAGGGAQDARGLFWVLDEEVHVEGSSD    981 - 1050
SVVLERLCAAFEKKGAGTEGSSALRTCEQPLQCEIFHQLGWDPVRYDLTGWLHRAKPNLSALDAPQVLHQ   1051 - 1120
SKREELRSLFQARAKLPPVCRAVAGLEGTSQQALQRSRMVRRTFASSLAAVRRKAPCSQIKLQMDALTSM   1121 - 1190
IKRSRLHFIHCLVPNPVVESRSGQESPPPPQPGRDKPGAGGPLALDIPALRVQLAGFHILEALRLHRTGY   1191 - 1260
ADHMGLTRFRRQFQVLDAPLLKKLMSTSEGIDERKAVEELLETLDLEKKAVAVGHSQVFLKAGVISRLEK   1261 - 1330
QREKLVSQSIVLFQAACKGFLSRQEFKKLKIRRLAAQCIQKNVAVFLAVKDWPWWQLLGSLQPLLSATIG   1331 - 1400
TEQLRAKEEELTTLRRKLEKSEKLRNELRQNTDLLESKIADLTSDLADERFKGDVACQVLESERAERLQA   1401 - 1470
FREVQELKSKHEQVQKKLGDVNKQLEEAQQKIQLNDLERNPTGGADEWQMRFDCAQMENEFLRKRLQQCE   1471 - 1540
ERLDSELTARKELEQKLGELQSAYDGAKKMAHQLKRKCHHLTCDLEDTCVLLENQQSRNHELEKKQKKFD   1541 - 1610
LQLAQALGESVFEKGLREKVTQENTSVRWELGQLQQQLKQKEQEASQLKQQVEMLQDHKRELLGSPSLGE   1611 - 1680
NCVAGLKERLWKLESSALEQQKIQSQQENTIKQLEQLRQRFELEIERMKQMHQKDREDQEEELEDVRQSC   1681 - 1750
QKRLHQLEMQLEQEYEEKQMVLHEKQDLEGLIGTLCDQIGHRDFDVEKRLRRDLRRTHALLSDVQLLLGT   1751 - 1820
MEDGKTSVSKEELEKVHSQLEQSEAKCEEALKTQKVLTADLESMHSELENMTRNKSLVDEQLYRLQFEKA   1821 - 1890
DLLKRIDEDQDDLNELMQKHKDLIAQSAADIGQIQELQLQLEEAKKEKHKLQEQLQVAQMRIEYLEQSTV   1891 - 1960
DRAIVSRQEAVICDLENKTEFQKVQIKRFEVLVIRLRDSLIKMGEELSQAATSESQQRESSQYYQRRLEE   1961 - 2030
LKADMEELVQREAEASRRCMELEKYVEELAAVRQTLQTDLETSIRRIADLQAALEEVASSDSDTESVQTA   2031 - 2100
VDCGSSGRKEMDNVSILSSQPEGSLQSWLSCTLSLATDTMRTPSRQSATSSRILSPRINEEAGDTERTQS   2101 - 2170
ALALSRARSTNVHSKTSGDKPVSPHFVRRQKYCHFGDGEVLAVQRKSTERLEPASSPLASRSTNTSPLSR   2171 - 2240
EKLPSPSAALSEFVEGLRRKRAQRGQGSTLGLEDWPTLPIYQTTGASTLRRGRAGSDEGNLSLRVGAKSP   2241 - 2310
LEIEGAAGGLLRSTSLKCISSDGVGGTTLLPEKSKTQFSSCESLLESRPSMGRKLSSPTTPRDMLLSPTL   2311 - 2380
RPRRRCLESSVDDAGCPDLGKEPLVFQNRQFAHLMEEPLGSDPFSWKLPSLDYERKTKVDFDDFLPAIRK   2381 - 2450
PQTPTSLAGSAKGGQDGSQRSSIHFETEEANRSFLSGIKTILKKSPEPKEDPAHLSDSSSSSGSIVSFKS   2451 - 2520
ADSIKSRPGIPRLAGDGGERTSPERREPGTGRKDDDVASIMKKYLQK                          2521 - 2567
//

Text Mined References (24)

PMID Year Title
25778778 2015 Lack of replication for the myosin-18B association with mathematical ability in independent cohorts.
25748484 2015 A novel syndrome of Klippel-Feil anomaly, myopathy, and characteristic facies is linked to a null mutation in MYO18B.
23423138 2013 A common variant in myosin-18B contributes to mathematical abilities in children with dyslexia and intraparietal sulcus variability in adults.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20713499 2010 Cross-disorder genomewide analysis of schizophrenia, bipolar disorder, and depression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17294804 2006 Restored expression of the MYO18B gene suppresses orthotopic growth and the production of bloody pleural effusion by human malignant pleural mesothelioma cells in SCID mice.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16499872 2006 MYO18B interacts with the proteasomal subunit Sug1 and is degraded by the ubiquitin-proteasome pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15305387 2004 Reduced expression of MYO18B, a candidate tumor-suppressor gene on chromosome arm 22q, in ovarian cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12741677 2003 Genetic alterations responsible for metastatic phenotypes of lung cancer cells.
12547197 2003 Human MYO18B, a novel unconventional myosin heavy chain expressed in striated muscles moves into the myonuclei upon differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12209013 2002 MYO18B, a candidate tumor suppressor gene at chromosome 22q12.1, deleted, mutated, and methylated in human lung cancer.
10591208 1999 The DNA sequence of human chromosome 22.