Property Summary

NCBI Gene PubMed Count 41
PubMed Score 32.88
PubTator Score 53.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -2.500 3.3e-07
oligodendroglioma 1.500 1.4e-02
psoriasis -2.100 1.2e-03
osteosarcoma 1.602 4.7e-02
sonic hedgehog group medulloblastoma -1.700 4.6e-04
acute quadriplegic myopathy 1.018 1.3e-03
Atopic dermatitis 1.400 2.2e-05
intraductal papillary-mucinous adenoma (... 1.700 3.5e-04
intraductal papillary-mucinous carcinoma... 2.100 7.1e-04
intraductal papillary-mucinous neoplasm ... 1.900 4.8e-03
colon cancer 1.100 3.6e-02
lung cancer 1.800 6.2e-03
cystic fibrosis 2.000 5.3e-05
ductal carcinoma in situ 1.100 1.0e-02
ulcerative colitis -1.100 2.1e-03
ovarian cancer 1.700 3.5e-03
pituitary cancer -2.100 5.5e-04
Down syndrome 1.400 2.0e-03

Gene RIF (22)

PMID Text
26573744 MYO10 (myosin X), a direct miR340 target gene, mediated the migration and invasion of breast cancer cells
26235048 Myo10 plays a key role in integrating the actin and microtubule cytoskeletons to position centrosomes and mitotic spindles.
25819274 New research implicates Myo10 in a number of disease states including cancer metastasis and pathogen infection.
25749519 Results suggest that NF-kappaB-regulated miR-124 targets MYO10, inhibits cell invasion and metastasis, and is down-regulated in node-positive NSCLC.
25605337 PCTK1 regulates spindle orientation through phosphorylation of Ser83 on KAP0, a regulatory subunit of protein kinase A.
24921915 Elevated MYO10 expression and involvement in invadopodia formation increases the aggressiveness of breast cancer .
24487586 Myo10 upregulation in mutant p53-driven cancers is necessary for invasion and that plasma-membrane protrusions.
24379415 Phosphorylation of ADD1 at Ser12 and Ser355 by cyclin-dependent kinase 1 enables ADD1 to bind to myosin-X (Myo10).
23943878 Study demonstrates a novel biological function for Hdl-Myo10 and an important new role for both Myo10 isoforms in the development of dendritic spines and synapses.
23083060 Authors conclude thatMyo10 generates the force to enhance bacterial-induced cell membrane protrusions by binding its head region to actin filaments and its PH tail domain to the peripheral membrane.
21642953 Molecular basis by which myosin-X facilitates alternative dual binding to cargos and microtubules.
21321230 The structure of the MyoX MyTH4-FERM tandem in complex with the cytoplasmic tail P3 domain of the netrin receptor DCC, is reported.
20930142 Results indicate that PtdIns(3,4,5)P binding to the Myo10-PH2 domain is involved in Myo10 trafficking and regulation of filopodia dynamics.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20123970 Results suggest that VE-cadherin trafficking along filopodia using myosin-X motor protein is a prerequisite for cell-cell junction formation.
19204726 Observational study of gene-disease association. (HuGE Navigator)
18818677 increased CLP expression and CLP-mediated Myo10 function are important for skin differentiation and wound reepithelialization
18599451 myosin X recognizes the local structural arrangement of filaments in long bundles, providing a mechanism for sorting cargo to distant target sites.
18295593 Our data suggest that CLP functions to increase translation of Myo10 possibly by acting as a chaperone for the emerging Myo10 heavy chain protein.
16894163 Data demonstrate that Myo10 is a molecular motor that functions in filopodia formation.
16371656 Results report that, in addition to full-length myosin 10 (Myo10), brain expresses a shorter form of Myo10 that lacks a myosin head domain.
15158464 M10 is a specific motor carrying Mena/VASP from the root to the tip of the filopodia where extension of actin filament takes place

AA Sequence

MDNFFTEGTRVWLRENGQHFPSTVNSCAEGIVVFRTDYGQVFTYKQSTITHQKVTAMHPTNEEGVDDMAS      1 - 70
LTELHGGSIMYNLFQRYKRNQIYTYIGSILASVNPYQPIAGLYEPATMEQYSRRHLGELPPHIFAIANEC     71 - 140
YRCLWKRHDNQCILISGESGAGKTESTKLILKFLSVISQQSLELSLKEKTSCVERAILESSPIMEAFGNA    141 - 210
KTVYNNNSSRFGKFVQLNICQKGNIQGGRIVDYLLEKNRVVRQNPGERNYHIFYALLAGLEHEEREEFYL    211 - 280
STPENYHYLNQSGCVEDKTISDQESFREVITAMDVMQFSKEEVREVSRLLAGILHLGNIEFITAGGAQVS    281 - 350
FKTALGRSAELLGLDPTQLTDALTQRSMFLRGEEILTPLNVQQAVDSRDSLAMALYACCFEWVIKKINSR    351 - 420
IKGNEDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLVWEDIDWIDNG    421 - 490
ECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRVAVNNFGVKHYAGEVQYDVRGI    491 - 560
LEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTLKCGSKHRRPTVSSQFKDSLHSLMATLSSSN    561 - 630
PFFVRCIKPNMQKMPDQFDQAVVLNQLRYSGMLETVRIRKAGYAVRRPFQDFYKRYKVLMRNLALPEDVR    631 - 700
GKCTSLLQLYDASNSEWQLGKTKVFLRESLEQKLEKRREEEVSHAAMVIRAHVLGFLARKQYRKVLYCVV    701 - 770
IIQKNYRAFLLRRRFLHLKKAAIVFQKQLRGQIARRVYRQLLAEKREQEEKKKQEEEEKKKREEEERERE    771 - 840
RERREAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDLQRMKEQQELS    841 - 910
LTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERSLSVGSEFSSELAESACEEKP    911 - 980
NFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSADST    981 - 1050
VLLAPSVQDSGSLHNSSSGESTYCMPQNAGDLPSPDGDYDYDQDDYEDGAITSGSSVTFSNSYGSQWSPD   1051 - 1120
YRCSVGTYNSSGAYRFSSEGAQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSFLYMKGGLMN   1121 - 1190
SWKRRWCVLKDETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEKLKGT   1191 - 1260
VEVRTAKEIIDNTTKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHASTDQEIQEMHDEQANPQNAV   1261 - 1330
GTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITLLQRSKGDTRVEGQEFIVRGWLH   1331 - 1400
KEVKNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNALKLGTLVLNSLCSVVPPDEKIFKETGYWNVTVYG   1401 - 1470
RKHCYRLYTKLLNEATRWSSAIQNVTDTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPL   1471 - 1540
HSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQL   1541 - 1610
IKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGSEMEKYALFTYESLKKTK   1611 - 1680
CREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGH   1681 - 1750
VDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHH   1751 - 1820
PAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFTPCERLEKRRTSFLEGTLR   1821 - 1890
RSFRTGSVVRQKVEEEQMLDMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDV   1891 - 1960
ECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVA   1961 - 2030
KLMKAYISMIVKKRYSTTRSASSQGSSR                                             2031 - 2058
//

Text Mined References (46)

PMID Year Title
26573744 2016 MiR-340 suppresses cell migration and invasion by targeting MYO10 in breast cancer.
26235048 2015 Direct Microtubule-Binding by Myosin-10 Orients Centrosomes toward Retraction Fibers and Subcortical Actin Clouds.
25819274 2015 Myosin-X and disease.
25749519 2015 NF-?B-mediated miR-124 suppresses metastasis of non-small-cell lung cancer by targeting MYO10.
25605337 2015 PCTK1 regulates integrin-dependent spindle orientation via protein kinase A regulatory subunit KAP0 and myosin X.
25416956 2014 A proteome-scale map of the human interactome network.
24921915 2014 Elevated expression of myosin X in tumours contributes to breast cancer aggressiveness and metastasis.
24487586 2014 Mutant p53-associated myosin-X upregulation promotes breast cancer invasion and metastasis.
24379415 2014 Adducin-1 is essential for mitotic spindle assembly through its interaction with myosin-X.
23943878 2013 Myosin X and its motorless isoform differentially modulate dendritic spine development by regulating trafficking and retention of vasodilator-stimulated phosphoprotein.
23704327 2013 The giant spectrin ?V couples the molecular motors to phototransduction and Usher syndrome type I proteins along their trafficking route.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23083060 2013 Myosin-X facilitates Shigella-induced membrane protrusions and cell-to-cell spread.
23012428 2012 Antiparallel coiled-coil-mediated dimerization of myosin X.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21642953 2011 Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain.
21321230 2011 Cargo recognition mechanism of myosin X revealed by the structure of its tail MyTH4-FERM tandem in complex with the DCC P3 domain.
20930142 2010 PtdIns(3,4,5)P? is a regulator of myosin-X localization and filopodia formation.
20682791 2010 A protein interaction network for Ecm29 links the 26 S proteasome to molecular motors and endosomal components.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20123970 2010 The motor protein myosin-X transports VE-cadherin along filopodia to allow the formation of early endothelial cell-cell contacts.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18818677 2009 Calmodulin-like protein upregulates myosin-10 in human keratinocytes and is regulated during epidermal wound healing in vivo.
18599451 2008 A myosin motor that selects bundled actin for motility.
18570893 2008 Interaction with the IQ3 motif of myosin-10 is required for calmodulin-like protein-dependent filopodial extension.
18295593 2008 Calmodulin-like protein enhances myosin-10 translation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16894163 2006 Myosin-X is a molecular motor that functions in filopodia formation.
16371656 2006 Myo10 in brain: developmental regulation, identification of a headless isoform and dynamics in neurons.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15158464 2004 Myosin X transports Mena/VASP to the tip of filopodia.
15156152 2004 Myosin-X provides a motor-based link between integrins and the cytoskeleton.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12055636 2002 Myosin X is a downstream effector of PI(3)K during phagocytosis.
11278607 2001 The tumor-sensitive calmodulin-like protein is a specific light chain of human unconventional myosin X.
10984435 2000 Myosin-X, a novel myosin with pleckstrin homology domains, associates with regions of dynamic actin.
10610710 1999 Physical map and characterization of transcripts in the candidate interval for familial chondrocalcinosis at chromosome 5p15.1.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8884266 1996 Mapping of unconventional myosins in mouse and human.