Property Summary

Ligand Count 1
NCBI Gene PubMed Count 15
PubMed Score 40.92
PubTator Score 13.84

Knowledge Summary

Patent (4,583)


  Disease (6)


  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy -1.057 8.5e-04
Duchenne muscular dystrophy -1.033 2.5e-06
psoriasis 1.200 5.0e-07

 MGI Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (7)

AA Sequence

KKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV                                      561 - 596

Text Mined References (15)

PMID Year Title