Property Summary

NCBI Gene PubMed Count 25
PubMed Score 73.65
PubTator Score 21.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.700 6.5e-06
osteosarcoma -1.711 2.8e-06
astrocytoma -1.100 2.7e-02
diabetes mellitus -1.100 2.9e-03

Gene RIF (4)

PMID Text
25010285 Interaction of HIV-1 Gag with myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6) is identified in a series of six affinity purification/mass spectrometry screens
23166591 Interaction of HIV-1 Gag with myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6) is identified in a series of six affinity purification/mass spectrometry screens
19794400 Interaction of HIV-1 Gag with myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6) is identified in a series of six affinity purification/mass spectrometry screens
19460752 Knockdown of myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHF      1 - 70
LPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCIN     71 - 140
YEAFVRHILSG                                                               141 - 151
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22114352 2012 A new role for the architecture of microvillar actin bundles in apical retention of membrane proteins.
21269460 2011 Initial characterization of the human central proteome.
21217774 2011 RAC3 is a pro-migratory co-activator of ER?.
21182205 2011 Identification of proteins associated with ligand-activated estrogen receptor ? in human breast cancer cell nuclei by tandem affinity purification and nano LC-MS/MS.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16953301 2006 Preparation of monoclonal antibodies against human ventricular myosin light chain 1 (HVMLC1) for functional studies.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14627618 2003 Smooth muscle contraction and relaxation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11436981 2001 Molecular cloning and sequencing of myosin light chains in human megakaryoblastic leukemia cells.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8856505 1996 The intracompartmental sorting of myosin alkali light chain isoproteins reflects the sequence of developmental expression as determined by double epitope-tagging competition.
8188229 1994 Molecular cloning, sequencing, and characterization of smooth muscle myosin alkali light chain from human eye cDNA: homology with myocardial fatty acid ethyl ester synthase-III cDNA.
2722814 1989 The alkali light chains of human smooth and nonmuscle myosins are encoded by a single gene. Tissue-specific expression by alternative splicing pathways.
2304459 1990 Characterization of human myosin light chains 1sa and 3nm: implications for isoform evolution and function.