Property Summary

NCBI Gene PubMed Count 23
PubMed Score 27.16
PubTator Score 35.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.772 9.8e-06
non diabetic and post-ischemic heart fai... 2.100 6.4e-03
psoriasis -1.300 9.4e-11

Gene RIF (7)

PMID Text
27066836 a novel, heterozygous p.Glu11Lys mutation in the atrial-specific myosin light chain gene MYL4, caused atrial fibrillation.
25807286 A recessive frameshift mutation in MYL4 causes early-onset atrial fibrillation.
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain
16106982 results demonstrate that the expression of hALC-1 could have a beneficial effect on the overloaded hypertrophied heart
10373429 NMR showed involvement of N-terminus and lysines 3 and 4 in interaction with actin. Mutations of these lysines (K3A,K4R,K4A,K4D) resulted in altered actin binding and actin activated MgATPase. Mutation of Ala-1 to val had no effect on binding or kinetics.
9738905 The N-terminus of this protein is an actin binding site.
9000508 The (Ala-Pro) rich part of this protein acts as a "spacer arm" responsible for correct positioning of the N-terminal actin binding site.

AA Sequence

MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGE      1 - 70
MKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLR     71 - 140
VFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG                 141 - 197
//

Text Mined References (24)

PMID Year Title
27066836 2016 A mutation in the atrial-specific myosin light chain gene (MYL4) causes familial atrial fibrillation.
25807286 2015 Large-scale whole-genome sequencing of the Icelandic population.
21269460 2011 Initial characterization of the human central proteome.
16675844 2006 Minigenes encoding N-terminal domains of human cardiac myosin light chain-1 improve heart function of transgenic rats.
16381901 2006 The LIFEdb database in 2006.
16106982 2005 Human atrial myosin light chain 1 expression attenuates heart failure.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14985854 2004 Functional characterization of the human atrial essential myosin light chain (hALC-1) in a transgenic rat model.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11557734 2001 Proteomic analysis of pharmacologically preconditioned cardiomyocytes reveals novel phosphorylation of myosin light chain 1.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10494800 1999 Tuning the human heart molecular motors by myosin light chains.
10373429 1999 Size and charge requirements for kinetic modulation and actin binding by alkali 1-type myosin essential light chains.
9738905 1998 The N-terminus of A1-type myosin essential light chains binds actin and modulates myosin motor function.
9180271 1997 Different actin affinities of human cardiac essential myosin light chain isoforms.
9000508 1997 The rôle of the proline-rich region in A1-type myosin essential light chains: implications for information transmission in the actomyosin complex.
6879193 1983 Human fetal muscle and cultured myotubes derived from it contain a fetal-specific myosin light chain.
3417683 1988 Molecular cloning and characterization of human atrial and ventricular myosin alkali light chain cDNA clones.
2849544 1988 A novel human myosin alkali light chain is developmentally regulated. Expression in fetal cardiac and skeletal muscle and in adult atria.
2458299 1988 Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms.
2308163 1990 Heterogenic mRNAs with an identical protein-coding region of the human embryonic myosin alkali light chain in skeletal muscle cells.
2129532 1990 Human embryonic/atrial myosin alkali light chain gene: characterization, sequence, and chromosomal location.
2027757 1991 The human embryonic myosin alkali light chain gene: use of alternative promoters and 3' non-coding regions.