Property Summary

NCBI Gene PubMed Count 23
PubMed Score 30.06
PubTator Score 35.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non diabetic and post-ischemic heart fai... 2.100 6.4e-03
osteosarcoma -3.520 1.6e-05
psoriasis -1.300 9.4e-11

Gene RIF (7)

AA Sequence

MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGE      1 - 70
MKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLR     71 - 140
VFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG                 141 - 197
//

Text Mined References (24)

PMID Year Title