Property Summary

NCBI Gene PubMed Count 64
PubMed Score 106.90
PubTator Score 142.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute quadriplegic myopathy -1.158 1.1e-05

 GWAS Trait (1)

Gene RIF (39)

PMID Text
26116789 Myosin regulatory light chain phosphorylation enhances cardiac beta-myosin in vitro motility under load.
26074085 This review focuses on the regulatory functions of MLC-2 in the embryonic and adult heart, with an emphasis on phosphorylation-driven actions of MLC-2v in adult cardiac muscle.
25925610 FLNb enhances invasion of cancer cells through phosphorylation of MRLC and FAK.
25825243 Data suggest a mutation in MYL2 (amino acid substitution D94A; novel mutation in familial dilated cardiomyopathy) does affect conformation (reduced alpha-helical content) and function (reduced binding of myosin heavy chain; increased ATPase) of MYL2.
24861553 Four novel body mass index-associated loci near the KCNQ1(rs2237892), ALDH2/MYL2 (rs671, rs12229654), ITIH4 (rs2535633) and NT5C2 (rs11191580) genes are identified in East Asian-ancestry populations.
24578133 The basic domain (49RKKRRQRRR57) of HIV-1 Tat is essential for enhancing the FGF-induced activation of ERK, Rho-A, and MLC2 and upregulates the expression of MMP-9 in human podocytes
24184274 an interplay between phosphorylation and glycosylation of MLC2, which might be involved in the development of muscle atrophy and associated changes
23951055 Results suggest that Aurora B, but not Rho/MLCK (myosin-light-chain kinase) signaling, is essential for the localization of 2P-MRLC (myosin regulatory light chains) to the midzone in dividing HeLa cells.
23732111 Ostf1b could constitutively activate the Rho kinase 1 (ROCK1) and myosin light chain 2 (MLC2) signalling pathway that promotes cell migration, epithelial mesenchymal transition (EMT) and cytoskeletal dynamics through stress fibre formation.
23575436 Newly implicated variants (MYL2, C12orf51 and OAS1) were found to be significantly associated with 1-h plasma glucose as predisposing risk factors for type 2 diabetes.
23365102 study concludes the mutations in the last exon of MYL2 are responsible for a novel autosomal recessive lethal myosinopathy due to defects changing the C-terminal tail of the ventricular form of the myosin regulatory light chain
23188716 NDRG1 inhibited an important regulatory pathway mediated by ROCK1/pMLC2 pathway that modulates stress fiber assembly.
22688514 AMPK mediates spindle pole-associated pMRLC(ser19) to control spindle orientation via regulation of actin cortex-astral microtubule attachments
22425609 MLC2 isoforms localisation is dependent on cell cycle in HeLa cells.
22120626 These data demonstrate that smMLCK is a specific and efficient kinase for the in vitro phosphorylation of MYL2, cardiac, and smooth muscle myosin.
22091967 results suggest that the A13T mutation triggers a hypertrophic response through changes in cardiac sarcomere organization and myosin cross-bridge function leading to abnormal remodelling of the heart.
21823217 This is the first report of mutations in TPM1, MY L3, and MYL2 associated with primary, non-hypertrophied restrictive cardiomyopathy.
21259275 MYL2 was down-expressed in heart failure tissues, and findings suggested that MYL2 may play a role in the development and progression of chronic heart failure.
20670370 Differential phosphorylation of myosin light chain (Thr)18 and (Ser)19 have functional implications in platelets
20634891 Observational study of gene-disease association. (HuGE Navigator)
20386496 Oxidative stress related to asphyxia induces nitration of cardiac MLC2 protein and thus increases its degradation. This and a large decrease in MLC2 phosphorylation contribute to the development of systolic dysfunction.
20359594 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20031618 Observational study of gene-disease association. (HuGE Navigator)
19875404 Observational study of gene-disease association. (HuGE Navigator)
19853701 Observational study of gene-disease association. (HuGE Navigator)
19794400 The basic domain (49RKKRRQRRR57) of HIV-1 Tat is essential for enhancing the FGF-induced activation of ERK, Rho-A, and MLC2 and upregulates the expression of MMP-9 in human podocytes
19345098 Data show that VE-cadherin signals to Rho-kinase-dependent myosin light-chain 2 phosphorylation, leading to actomyosin contractility, which regulates the distribution of VE-cadherin at cell-cell junctions and sprouting.
19293840 Observational study of gene-disease association. (HuGE Navigator)
19254691 These results indicate that diphosphorylation of regulatory light chain of myosin IIA by Rho-kinase in lamella is responsible for the cell to spread properly.
18987303 Profound cellular changes observed in Tg-D166V myocardium when placed in vivo could trigger a series of pathological responses and result in poor prognosis for D166V-positive patients.
18948272 Following down-regulation of MR-1, the phosphorylations of MLC2, focal adhesion kinase (FAK), and Akt were dramatically decreased
18648664 DLC1 negatively regulates Rho/ROCK/MLC2
18513529 Observational study of gene-disease association. (HuGE Navigator)
18403758 Observational study of gene-disease association. (HuGE Navigator)
17244674 MLC2 phosphorylation is regulated by both ROCK and MLC kinase and plays an important role in platelet biogenesis by controlling proplatelet formation and fragmentation.
16199542 Observational study of gene-disease association. (HuGE Navigator)
12404107 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12185584 diphosphorylated MRLC and Rho-kinase accumulated and colocalized at the contractile ring and the midbody in dividing cells
11748309 mutations in familial hypertrophic cardiomyopathy: phenotypic presentation and frequency in Danish and South African populations

AA Sequence

MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMI      1 - 70
KEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA     71 - 140
AFPPDVTGNLDYKNLVHIITHGEEKD                                                141 - 166
//

Text Mined References (65)

PMID Year Title
26116789 2015 Myosin regulatory light chain phosphorylation enhances cardiac ?-myosin in vitro motility under load.
26074085 2015 Functions of myosin light chain-2 (MYL2) in cardiac muscle and disease.
25925610 2015 Filamin B Enhances the Invasiveness of Cancer Cells into 3D Collagen Matrices.
25825243 2015 Novel familial dilated cardiomyopathy mutation in MYL2 affects the structure and function of myosin regulatory light chain.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24184274 2013 Potential regulation of human muscle plasticity by MLC2 post-translational modifications during bed rest and countermeasures.
23951055 2013 Aurora B but not rho/MLCK signaling is required for localization of diphosphorylated myosin II regulatory light chain to the midzone in cytokinesis.
23732111 2013 Osmotic stress transcription factor 1b (Ostf1b) promotes migration properties with the modulation of epithelial mesenchymal transition (EMT) phenotype in human embryonic kidney cell.
23575436 2013 New susceptibility loci in MYL2, C12orf51 and OAS1 associated with 1-h plasma glucose as predisposing risk factors for type 2 diabetes in the Korean population.
23365102 2013 Recessive MYL2 mutations cause infantile type I muscle fibre disease and cardiomyopathy.
23364394 2013 A genome-wide association study of a coronary artery disease risk variant.
23364009 2013 Common variants at 12q24 are associated with drinking behavior in Han Chinese.
23188716 2013 Targeting the metastasis suppressor, NDRG1, using novel iron chelators: regulation of stress fiber-mediated tumor cell migration via modulation of the ROCK1/pMLC2 signaling pathway.
22688514 2012 AMPK regulates mitotic spindle orientation through phosphorylation of myosin regulatory light chain.
22425609 2012 Gene duplication and conversion events shaped three homologous, differentially expressed myosin regulatory light chain (MLC2) genes.
22120626 2011 Smooth muscle myosin light chain kinase efficiently phosphorylates serine 15 of cardiac myosin regulatory light chain.
22091967 2012 Myosin regulatory light chain mutation found in hypertrophic cardiomyopathy patients increases isometric force production in transgenic mice.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21823217 2011 Furthering the link between the sarcomere and primary cardiomyopathies: restrictive cardiomyopathy associated with multiple mutations in genes previously associated with hypertrophic or dilated cardiomyopathy.
21270382 2011 Genome-wide association studies identify genetic loci related to alcohol consumption in Korean men.
21259275 2011 Slow cardiac myosin regulatory light chain 2 (MYL2) was down-expressed in chronic heart failure patients.
20670370 2010 Differential phosphorylation of myosin light chain (Thr)18 and (Ser)19 and functional implications in platelets.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20445002 2010 A novel, in-solution separation of endogenous cardiac sarcomeric proteins and identification of distinct charged variants of regulatory light chain.
20386496 2010 Neonatal asphyxia induces the nitration of cardiac myosin light chain 2 that is associated with cardiac systolic dysfunction.
20359594 2010 Clinical features and outcome of hypertrophic cardiomyopathy associated with triple sarcomere protein gene mutations.
20038585 2010 Cardiac myosin is a substrate for zipper-interacting protein kinase (ZIPK).
20031618 2009 Prevalence of sarcomere protein gene mutations in preadolescent children with hypertrophic cardiomyopathy.
19875404 2009 The role of Lamin A/C mutations in Danish patients with idiopathic dilated cardiomyopathy.
19853701 2009 Histologic characterization of hypertrophic cardiomyopathy with and without myofilament mutations.
19345098 2009 VE-Cadherin-mediated cell-cell interaction suppresses sprouting via signaling to MLC2 phosphorylation.
19293840 2009 The role of sarcomere gene mutations in patients with idiopathic dilated cardiomyopathy.
19254691 2009 Diphosphorylation of regulatory light chain of myosin IIA is responsible for proper cell spreading.
18987303 2009 Malignant familial hypertrophic cardiomyopathy D166V mutation in the ventricular myosin regulatory light chain causes profound effects in skinned and intact papillary muscle fibers from transgenic mice.
18948272 2008 MR-1 modulates proliferation and migration of human hepatoma HepG2 cells through myosin light chains-2 (MLC2)/focal adhesion kinase (FAK)/Akt signaling pathway.
18648664 2008 Deleted in liver cancer 1 (DLC1) negatively regulates Rho/ROCK/MLC pathway in hepatocellular carcinoma.
18513529 2008 Relationship between sex, shape, and substrate in hypertrophic cardiomyopathy.
18403758 2008 Shared genetic causes of cardiac hypertrophy in children and adults.
17885681 2007 A cardiac myosin light chain kinase regulates sarcomere assembly in the vertebrate heart.
17244674 2007 Proplatelet formation is regulated by the Rho/ROCK pathway.
17043135 2006 Endosomes generate localized Rho-ROCK-MLC2-based contractile signals via Endo180 to promote adhesion disassembly.
16754800 2006 Single-gene mutations and increased left ventricular wall thickness in the community: the Framingham Heart Study.
16555005 2006 The Tre2 oncoprotein, implicated in Ewing's sarcoma, interacts with two components of the cytoskeleton.
16199542 2005 Compound and double mutations in patients with hypertrophic cardiomyopathy: implications for genetic testing and counselling.
15967462 2005 MURF-1 and MURF-2 target a specific subset of myofibrillar proteins redundantly: towards understanding MURF-dependent muscle ubiquitination.
15824735 2005 Identification of novel VHL target genes and relationship to hypoxic response pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14756420 2003 Human fast skeletal myosin light chain 2 cDNA: isolation, tissue specific expression of the single copy gene, comparative sequence analysis of isoforms and evolutionary relationships.
12818575 2003 Identification of the genotypes causing hypertrophic cardiomyopathy in northern Sweden.
12707239 2003 Hypertrophic cardiomyopathy: distribution of disease genes, spectrum of mutations, and implications for a molecular diagnosis strategy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12404107 2002 Systematic analysis of the regulatory and essential myosin light chain genes: genetic variants and mutations in hypertrophic cardiomyopathy.
12185584 2002 Rho-kinase contributes to diphosphorylation of myosin II regulatory light chain in nonmuscle cells.
11891719 2002 Phosphorylation at threonine-18 in addition to phosphorylation at serine-19 on myosin-II regulatory light chain is a mitosis-specific event.
11773029 2002 Protein interactions with myocilin.
11748309 2001 Myosin light chain mutations in familial hypertrophic cardiomyopathy: phenotypic presentation and frequency in Danish and South African populations.
11102452 2001 Familial hypertrophic cardiomyopathy mutations in the regulatory light chains of myosin affect their structure, Ca2+ binding, and phosphorylation.
10047984 1998 Phosphorylation of non-muscle myosin II regulatory light chain by p21-activated kinase (gamma-PAK).
9535554 1998 Identification of two novel mutations in the ventricular regulatory myosin light chain gene (MYL2) associated with familial and classical forms of hypertrophic cardiomyopathy.
9180271 1997 Different actin affinities of human cardiac essential myosin light chain isoforms.
8673105 1996 Mutations in either the essential or regulatory light chains of myosin are associated with a rare myopathy in human heart and skeletal muscle.
8287067 1993 Interaction of a conserved peptide domain in recombinant human ventricular myosin light chain-2 with myosin heavy chain.
7498159 1995 The major protein expression profile and two-dimensional protein database of human heart.
2704627 1989 Isolation and nucleotide sequence of the cDNA encoding human ventricular myosin light chain 2.
1386340 1992 Localization of the gene coding for ventricular myosin regulatory light chain (MYL2) to human chromosome 12q23-q24.3.