Property Summary

NCBI Gene PubMed Count 18
PubMed Score 127.35
PubTator Score 57.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.5e-10
malignant mesothelioma 3163 3.5e-07
lung cancer 4473 6.0e-06
medulloblastoma, large-cell 6234 2.3e-03

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 4.600 3.5e-07
medulloblastoma, large-cell 2.300 2.3e-03
lung cancer -2.800 6.0e-06
ovarian cancer 1.400 2.5e-10

Gene RIF (6)

PMID Text
26011449 This study provides an additional mechanistic link between Angiotensin II and vasoconstriction via SFK-enhanced MLC phosphorylation in smooth muscle cells.
23319595 MRK is a novel RhoC effector that controls LPA-stimulated cell invasion at least in part by regulating myosin dynamics, ERK and p38
22131351 Disturbed myosin binding of mutated hVLC-1 may provide a pathomechanism for the development of hypertrohic cardiomyopathy.
21731751 Influenza infection activates a series of signaling pathways that converge to induce myosin light chain (MLC) phosphorylation and remodeling of the actin cytoskeleton.
20518849 In vitro degradation of human recombinant MLC1 by MMP-2 increased after ONOO(-) exposure of MLC1 in a concentration-dependent manner
19794400 Treatment of human brain endothelial cells with Tat markedly elevates GTP-RhoA levels and the potential downstream effectors, such as myosin phosphatase target subunit 1 and myosin light chain

AA Sequence

MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKI      1 - 70
TLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFD     71 - 140
KEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI                    141 - 194
//

Text Mined References (19)

PMID Year Title
26011449 2015 Src Family Kinases (SFK) Mediate Angiotensin II-Induced Myosin Light Chain Phosphorylation and Hypertension.
23319595 2013 The MLK-related kinase (MRK) is a novel RhoC effector that mediates lysophosphatidic acid (LPA)-stimulated tumor cell invasion.
22131351 2012 Mutations of ventricular essential myosin light chain disturb myosin binding and sarcomeric sorting.
21731751 2011 Inhibition of MLC phosphorylation restricts replication of influenza virus--a mechanism of action for anti-influenza agents.
20518849 2011 Ischemia induced peroxynitrite dependent modifications of cardiomyocyte MLC1 increases its degradation by MMP-2 leading to contractile dysfunction.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707283 2001 Interaction of ADP-ribosylated actin with actin binding proteins.
11071908 2000 A nonerythroid isoform of protein 4.1R interacts with components of the contractile apparatus in skeletal myofibers.
10998640 2000 Modular regulation of the MLC1F/3F gene and striated muscle diversity.
8145163 1993 Maximum velocity of shortening in relation to myosin isoform composition in single fibres from human skeletal muscles.
3904738 1985 The myosin alkali light chain proteins and their genes.
3601661 1987 The complete nucleotide sequences of cDNA clones coding for human myosin light chains 1 and 3.
3422212 1988 Assignment of the human fast skeletal muscle myosin alkali light chains gene (MLC1F/MLC3F) to 2q 32.1-2qter.
2777779 1989 Identification of the functional promoter regions in the human gene encoding the myosin alkali light chains MLC1 and MLC3 of fast skeletal muscle.
2458299 1988 Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms.
2304459 1990 Characterization of human myosin light chains 1sa and 3nm: implications for isoform evolution and function.