Property Summary

NCBI Gene PubMed Count 66
PubMed Score 55.37
PubTator Score 31.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -1.400 5.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.594 3.1e-03
cystic fibrosis -1.305 1.4e-05
Duchenne muscular dystrophy 1.124 2.7e-07
glioblastoma -1.200 1.1e-02
group 4 medulloblastoma -1.400 2.7e-03
head and neck cancer -1.400 1.8e-02
Hydrolethalus syndrome -1.637 2.8e-02
intraductal papillary-mucinous adenoma (... -3.600 1.4e-05
intraductal papillary-mucinous carcinoma... -3.400 2.2e-04
intraductal papillary-mucinous neoplasm ... -2.800 5.6e-03
juvenile dermatomyositis 1.405 1.8e-10
lung adenocarcinoma -1.300 1.1e-13
lung cancer -1.100 3.0e-03
lung carcinoma -1.600 1.3e-12
medulloblastoma, large-cell -1.200 1.7e-02
non-small cell lung cancer -1.311 2.0e-12
osteosarcoma -1.766 1.8e-04
ovarian cancer -2.000 1.3e-05
pancreatic cancer 1.300 2.0e-02
Parkinson's disease -1.300 2.8e-02
primary pancreatic ductal adenocarcinoma 1.297 3.5e-02
psoriasis -2.900 6.4e-05
ulcerative colitis 1.200 3.9e-03

Gene RIF (44)

AA Sequence

MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAM      1 - 70
VNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIE     71 - 140
MYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRKDHNI    141 - 210
PGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERT    211 - 280
FHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVV    281 - 350
SSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFA    351 - 420
VEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHT    421 - 490
MFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSH    491 - 560
SKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDVDRIVGLDQ    561 - 630
VTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLR    631 - 700
CNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFF    701 - 770
RAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTK    771 - 840
VKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMR    841 - 910
ARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKI    911 - 980
KKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTR    981 - 1050
QELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEEELQGALARGDDETLHKNNALKVVRELQAQI   1051 - 1120
AELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNH   1121 - 1190
EAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQ   1191 - 1260
VQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASLESQLQDTQELLQEETRQ   1261 - 1330
KLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKD   1331 - 1400
AEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNLEKKQKKFDQLLAEEKSISARYAEE   1401 - 1470
RDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQ   1471 - 1540
VEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERK   1541 - 1610
QRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEK   1611 - 1680
KLKSLEAEILQLQEELASSERARRHAEQERDELADEITNSASGKSALLDEKRRLEARIAQLEEELEEEQS   1681 - 1750
NMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALE   1751 - 1820
AKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAE   1821 - 1890
EEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDT   1891 - 1960
ESKTSDVNETQPPQSE                                                         1961 - 1976
//

Text Mined References (87)

PMID Year Title