Property Summary

NCBI Gene PubMed Count 43
PubMed Score 66.55
PubTator Score 15.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 5.7e-06
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 5.7e-06

Gene RIF (28)

PMID Text
26059207 Transcriptional levels of MHC-I, MHC-IIa, and MHC-IIb in denervation groups were significantly down-regulated compared with controls
25567808 Myosin isoforms impact single-fiber force generation and may lead to alterations in whole skeletal muscle performance.
22489880 adaptive response to reduced masticatory load was lower numerical and area proportion of MyHC-1 expressing fibres and higher numerical proportion of hybrid fibres in edentulous compared with dentate subjects
22337492 The human genioglossus muscle is composed of conventional myosin heavy chain isoforms and 3 primary myosin heavy chain phenotypes.
21470888 the expression levels of the MHC genes are associated with age and both PGC-1alpha and PGC-1beta and indicate that the MHC genes may to some extent be used to determine fibre-type composition in human skeletal muscle.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20357587 Observational study of gene-disease association. (HuGE Navigator)
19932167 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19888426 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19169759 Observational study of gene-disease association. (HuGE Navigator)
18848840 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18495334 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17949294 Observational study of gene-disease association. (HuGE Navigator)
17916367 we found a higher percentage of fibers expressing fast MyHC IIx in tetraplegic cerebral palsy
17853024 Patients on hemodialysis demonstrate relatively fewer type 1 and consequently more type 2x fibres, with a corresponding change in MHC isoforms (MHC I and MHC IIX) in the skeletal muscle.
17674103 Observational study of genotype prevalence. (HuGE Navigator)
17524638 Observational study of genotype prevalence. (HuGE Navigator)
17368238 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17252231 Observational study of gene-disease association. (HuGE Navigator)
17196619 frequency of fibers expressing myosin heavy chain (MyHC) IIx increased in spastic paresis
16929514 Observational study of gene-disease association. (HuGE Navigator)
16492921 Observational study of gene-disease association. (HuGE Navigator)
16292541 Observational study of gene-disease association. (HuGE Navigator)
15932553 Observational study of genotype prevalence. (HuGE Navigator)
15034862 Observational study of gene-disease association. (HuGE Navigator)
11971910 Modular organization of phylogenetically conserved domains controlling developmental regulation of the human skeletal gene family

AA Sequence

MSSDSEMAIFGEAAPFLRKSERERIEAQNKPFDAKTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATV      1 - 70
TVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVV     71 - 140
TAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEV    141 - 210
TSGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQL    211 - 280
KAERSYHIFYQIMSNKKPDLIEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIEILGFTSDERV    281 - 350
SIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLQNLNSADLLKALCYPRVKVGNEYVTKGQTV    351 - 420
QQVYNAVGALAKAVYDKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQ    421 - 490
FFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHL    491 - 560
GKSNNFQKPKPAKGKPEAHFSLIHYAGTVDYNIAGWLDKNKDPLNETVVGLYQKSAMKTLALLFVGATGA    561 - 630
EAEAGGGKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCN    631 - 700
GVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFK    701 - 770
AGLLGLLEEMRDEKLAQLITRTQAMCRGFLARVEYQKMVERRESIFCIQYNVRAFMNVKHWPWMKLYFKI    771 - 840
KPLLKSAETEKEMANMKEEFEKTKEELAKTEAKRKELEEKMVTLMQEKNDLQLQVQAEADSLADAEERCD    841 - 910
QLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVK    911 - 980
NLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKIKLEQQVDDLEGSLEQEKKIRM    981 - 1050
DLERAKRKLEGDLKLAQESTMDIENDKQQLDEKLKKKEFEMSGLQSKIEDEQALGMQLQKKIKELQARIE   1051 - 1120
ELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHE   1121 - 1190
ATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNMETVSKAKGNLEKMCRALEDQL   1191 - 1260
SEIKTKEEEQQRLINDLTAQRARLQTESGEYSRQLDEKDTLVSQLSRGKQAFTQQIEELKRQLEEEIKAK   1261 - 1330
SALAHALQSSRHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQR   1331 - 1400
LQDAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKILAEWKQKCEETHAE   1401 - 1470
LEASQKESRSLSTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQE   1471 - 1540
KSELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQMKRNHIRIVESMQSTLDAEIR   1541 - 1610
SRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQAILKDTQLHLDDALRSQEDLKEQLAMVER   1611 - 1680
RANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIIQ   1681 - 1750
EARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLE   1751 - 1820
ARVRELEGEVESEQKRNVEAVKGLRKHERKVKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAE   1821 - 1890
EQSNVNLSKFRRIQHELEEAEERADIAESQVNKLRVKSREVHTKIISEE                        1891 - 1939
//

Text Mined References (47)

PMID Year Title
26059207 2015 Transition of myosin heavy chain isoforms in human laryngeal abductors following denervation.
25567808 2015 Molecular determinants of force production in human skeletal muscle fibers: effects of myosin isoform expression and cross-sectional area.
25416956 2014 A proteome-scale map of the human interactome network.
22489880 2012 Wearing of complete dentures reduces slow fibre and enhances hybrid fibre fraction in masseter muscle.
22337492 2012 Myosin heavy chain composition of the human genioglossus muscle.
21470888 2011 The expression of myosin heavy chain (MHC) genes in human skeletal muscle is related to metabolic characteristics involved in the pathogenesis of type 2 diabetes.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20357587 Evaluation of embryonic and perinatal myosin gene mutations and the etiology of congenital idiopathic clubfoot.
19932167 2010 A common mutation of the MYH gene is associated with increased DNA oxidation and age-related diseases.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19888426 2009 Analysis of candidate genes in occurrence and growth of colorectal adenomas.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19169759 2009 APC, MYH, and the correlation genotype-phenotype in colorectal polyposis.
18987736 2008 DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
18848840 2008 Genetic polymorphisms in hMTH1, hOGG1 and hMYH and risk of chronic benzene poisoning in a Chinese occupational population.
18495334 2008 The role of MYH gene in genetic predisposition to colorectal cancer: another piece of the puzzle.
18310078 2008 Deletion of the protein kinase A/protein kinase G target SMTNL1 promotes an exercise-adapted phenotype in vascular smooth muscle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17949294 2007 Similar colorectal cancer risk in patients with monoallelic and biallelic mutations in the MYH gene identified in a population with adenomatous polyposis.
17916367 2008 Higher amount of MyHC IIX in a wrist flexor in tetraplegic compared to hemiplegic cerebral palsy.
17853024 2007 Myosin heavy-chain isoform distribution, fibre-type composition and fibre size in skeletal muscle of patients on haemodialysis.
17674103 2007 Colorectal adenomatous polyposis Associated with MYH mutations: genotype and phenotype characteristics.
17524638 2007 Mutation analysis of the MYH gene in unrelated Czech APC mutation-negative polyposis patients.
17368238 2007 Identification of MYH mutation carriers in colorectal cancer: a multicenter, case-control, population-based study.
17252231 2007 MYH, OGG1, MTH1, and APC alterations involved in the colorectal tumorigenesis of Korean patients with multiple adenomas.
17196619 2007 Decreased capillarization and a shift to fast myosin heavy chain IIx in the biceps brachii muscle from young adults with spastic paresis.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16929514 2006 Germline mutations and polymorphic variants in MMR, E-cadherin and MYH genes associated with familial gastric cancer in Jiangsu of China.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16492921 2006 Risk of colorectal cancer in monoallelic and biallelic carriers of MYH mutations: a population-based case-family study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16292541 2006 MYH Y165C and G382D mutations in hepatocellular carcinoma and cholangiocarcinoma patients.
15932553 2005 Is prophylactic colectomy indicated in patients with MYH-associated polyposis?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15121898 2004 The composition of Staufen-containing RNA granules from human cells indicates their role in the regulated transport and translation of messenger RNAs.
15034862 2004 Role of inherited defects of MYH in the development of sporadic colorectal cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11971910 2002 Modular organization of phylogenetically conserved domains controlling developmental regulation of the human skeletal myosin heavy chain gene family.
11018701 2000 Intermuscular and intramuscular differences in myosin heavy chain composition of the human masticatory muscles.
10909963 2000 Fiber type-specific expression of GLUT4 in human skeletal muscle: influence of exercise training.
10388558 1999 Comparative sequence analysis of the complete human sarcomeric myosin heavy chain family: implications for functional diversity.
10077619 1999 Organization of human and mouse skeletal myosin heavy chain gene clusters is highly conserved.
7545970 1994 Type IIx myosin heavy chain transcripts are expressed in type IIb fibers of human skeletal muscle.
6304733 1983 Isolation and characterization of human myosin heavy chain genes.
2421254 1986 Characterization of diverse forms of myosin heavy chain expressed in adult human skeletal muscle.
1465443 1992 Organization of the human skeletal myosin heavy chain gene cluster.