Property Summary

NCBI Gene PubMed Count 23
PubMed Score 298.84
PubTator Score 111.83

Knowledge Summary

Patent

No data available

Gene RIF (9)

AA Sequence

MDVMDGCQFSPSEYFYDGSCIPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTGHHQAGHCLMW      1 - 70
ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQELLRE     71 - 140
QVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATDKNSLSSLDCLSNI    141 - 210
VDRITSSEQPGLPLQDLASLSPVASTDSQPATPGASSSRLIYHVL                             211 - 255
//

Text Mined References (24)

PMID Year Title