Property Summary

NCBI Gene PubMed Count 14
PubMed Score 14.85
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (8)

PMID Text
21624008 The results of these studies provide supporting evidence for MYEOV and NEGR1 as gene targets of 11q13 gains and 1p31 deletions in a neuroblastoma subset.
20854874 MYEOV expression is a prognostic factor for patients with multiple myeloma, in part through a role of MYEOV in the control of MMC proliferation.
20569498 High MYEOV is associated with colon cancer cell migration.
17390055 Both myeov and hst (fgf4) are normally situated approximately 475-kb apart at band 11q13, a region that is frequently amplified and overexpressed in various tumours.
16678123 These data suggest that ETV4 and Myeov may provide novel targets for therapeutic intervention.
16552434 The putative role for MYEOV genes may provide important targets for intervention in Gastric adenocarcinoma, evidenced by their role in promoting invasion and proliferation, key phenotypic hallmarks of cancer cells.
16275643 MYEOV protein synthesis is regulated by upstream open reading frames
12202983 Epigenetic inactivation of myeov is associated with esophageal squamous cell carcinomas

AA Sequence

MALRICVTYTPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMFTRQAGHFVEG      1 - 70
SKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAGLSQEAEDVDVSRARRVTDAP     71 - 140
QGTLCGTGNRNSGSQSARVVGVAHLGEAFRVGVEQAISSCPEEVHGRHGLSMEIMWARMDVALRSPGRGL    141 - 210
LAGAGALCMTLAESSCPDYERGRRACLTLHRHPTPHCSTWGLPLRVAGSWLTVVTVEALGGWRMGVRRTG    211 - 280
QVGPTMHPPPVSGASPLLLHHLLLLLLIIILTC                                         281 - 313
//

Text Mined References (15)

PMID Year Title
24740154 2014 Genome-wide association scan for variants associated with early-onset prostate cancer.
21624008 2011 Aberrations of NEGR1 on 1p31 and MYEOV on 11q13 in neuroblastoma.
20854874 2010 MYEOV is a prognostic factor in multiple myeloma.
20569498 2010 MYEOV (myeloma overexpressed gene) drives colon cancer cell migration and is regulated by PGE2.
20453838 2010 Genome-wide association study identifies five new breast cancer susceptibility loci.
17390055 2007 Rearrangement and expression of myeov and hst in NIH/3T3 transfectants: a caveat for the interpretation of DNA transfection analyses.
16678123 2006 ETV4 and Myeov knockdown impairs colon cancer cell line proliferation and invasion.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16552434 2006 Net1 and Myeov: computationally identified mediators of gastric cancer.
16341674 2005 Transcriptome analysis of human gastric cancer.
16275643 2006 Control of MYEOV protein synthesis by upstream open reading frames.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12202983 2002 MYEOV, a gene at 11q13, is coamplified with CCND1, but epigenetically inactivated in a subset of esophageal squamous cell carcinomas.
10753852 2000 Concurrent activation of a novel putative transforming gene, myeov, and cyclin D1 in a subset of multiple myeloma cell lines with t(11;14)(q13;q32).