Property Summary

NCBI Gene PubMed Count 10
PubMed Score 194.64
PubTator Score 71.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.100 6.0e-03
Multiple myeloma 2.044 1.5e-04
ovarian cancer 1.700 4.6e-05
pancreatic ductal adenocarcinoma liver m... -2.194 1.9e-03
psoriasis 1.500 5.7e-05

Gene RIF (4)

AA Sequence

MAAPSGGWNGVGASLWAALLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQ      1 - 70
GGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEE     71 - 140
FEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL                                         141 - 173
//

Text Mined References (15)

PMID Year Title