Property Summary

NCBI Gene PubMed Count 326
PubMed Score 1606.05
PubTator Score 663.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -2.100 7.2e-08
cutaneous lupus erythematosus 1.300 2.7e-04
psoriasis 1.800 5.8e-05
glioblastoma 2.200 2.6e-04
astrocytoma 1.600 1.6e-02
primitive neuroectodermal tumor 1.300 4.0e-03
juvenile dermatomyositis 1.334 1.6e-12
intraductal papillary-mucinous neoplasm ... 2.000 6.9e-04
lung cancer -2.200 4.2e-05
Multiple Sclerosis 1.200 4.0e-04
pediatric high grade glioma 1.600 8.3e-06
pilocytic astrocytoma 1.600 6.2e-07
subependymal giant cell astrocytoma 1.538 2.0e-02
lung carcinoma -1.200 1.4e-16
ovarian cancer 1.800 6.0e-06

Gene RIF (274)

PMID Text
27079437 these results suggest that targeting the COX-2/PGE2 pathway together with TLR/MyD88 signaling, which would suppress the inflammatory microenvironment and maintenance of stemness, could be an effective preventive or therapeutic strategy for gastric cancer
26900675 MYD88 gene analysis is a helpful ancillary tool for diagnosing vitreoretinal lymphoma (VRL)
26752547 MYD88 L265P and CD79B mutations were frequently detected in primary breast diffuse large B-cell lymphoma.
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26719415 Deubiquitinase CYLD negatively regulates MyD88-mediated signaling by directly interacting with MyD88 and deubiquitinating nontypeable Haemophilus influenzae (NTHi)-induced K63-linked polyubiquitination of MyD88 at lysine 231.
26711529 These results indicate that the LPS/IL-1beta-MyD88 axis plays a crucial role for stabilization of IkappaB-zeta mRNA.
26669856 MyD88s is positively regulated by IKKbeta and CREB and negatively regulated by ERK1/2 signaling pathways.
26600481 MyD88 was expressed at a higher level in NSCLC tissues and was closely associated with poor prognosis.
26592460 Data show that sterile alpha- and armadillo-motif-containing protein (SARM) modulates MyD88 protein-mediated Toll-like receptors (TLRs) activation through BB-loop dependent interleukin-1 receptor (TIR) TIR-TIR interactions.
26563875 Knockdown of MyD88 significantly inhibited matrix metalloproteinase expression in chondrocytes.
26548862 Study showed that MyD88 Toll/interleukin-1 receptor (TIR) domain interacted with TLR5TIR but not with TLR6TIR. The solubility of both TLR5TIR and TLR6TIR were influenced by its binding partner MyD88TIR.
26468534 Kaposi's sarcoma-associated herpesvirus RTA specifically reduces the steady-state protein levels of MyD88, and physiological levels of MyD88 are downregulated during viral lytic replication when RTA is expressed.
26466961 LPS-induced increases in intestinal TJP and intestinal inflammation were regulated by TLR4-dependent activation of the FAK/MyD88/IL-1R-associated kinase 4 signaling pathway.
26388135 the MYD88 mutation is a fairly consistent genetic feature in testicular diffuse large B-cell lymphoma
26363072 Cardiac RNA induces inflammatory responses in cardiomyocytes and immune cells via MyD88-TLR7 signaling.
26294719 our findings question the recent proposal that MYD88 mutant cases of chronic lymphocytic leukemia may display a distinct clinical behavior attributed solely to the mutations themselves
26261595 TLR4 and MyD88 expression might be associated with breast cancer growth and regional and distant metastases.
26244327 Findings support the association between MYD88 mutations and a response to ibrutinib therapy in patients with Waldenstrom's Macroglobulinemia.
26230596 This study confirms the strong association of the MYD88 L265P mutation with Lymphoplasmacytic lymphoma
26223974 Our findings suggest that miRNA-149 mediates the susceptibility of paclitaxel by regulating MyD88 expression in ovarian cancer cells.
26159625 The MYD88 L265P mutation is a novel sensitive diagnostic marker for Bing-Neel syndrome.
26099629 Results indicate that harboring MYD88 mutation is associated with increased risk of disease progression and poor prognosis in PCMZL.
26075815 This is the first study to show an association between single nucleotide polymorphisms in IRAK1, IRAK4 and MyD88, and the presence of severe invasive pneumococcal disease.
25978699 aimed to determine the MYD88 L265P mutation frequency, the level of MYD88 expression, and their associations with clinicopathological parameters in mature B-cell non-Hodgkin lymphomas
25969543 Activation of MyD88-dependent TLR1/2 signaling by misfolded alpha-synuclein, a protein linked to neurodegenerative disorders.
25900979 MYD88 mutations, especially L265P, are very frequent in Vitreoretinal lymphoma and their detection significantly improves the diagnostic yield of vitrectomy specimens.
25886387 findings suggest that rare, functional variants in MYD88, IRAK4 or IKBKG do not significantly contribute to IPD susceptibility in adults at the population level
25877355 TLR2-MyD88 signaling pathway may take part in the overexpression of miR-146a in monocytes stimulated with HCV core protein
25870959 immune surveillance and inflammatory responses occur in neurodegenerative diseases and toll-like receptor MYD88 signaling plays a critical role in these diseases--{REVIEW}
25819228 the detection of MYD88 L265P mutation in FFPE samples is reliable and useful for subtyping small B-cell lymphomas in BM biopsies. In addition, the presence of CXCR4 mutations identifies a subgroup of LPL patients with higher disease activity.
25816840 Allele-specific PCR is a powerful tool for the detection of the MYD88 L265P mutation in diffuse large B cell lymphoma and decalcified bone marrow samples.
25768255 Myd-88 L265P constitutive activating mutations are present in at least some cases of the diffuse large B-cell lymphoma form of vitreoretinal lymphoma.
25766528 Low level of miR-940 and high level of MyD88 in PDAC promoted PDAC cells growth which might be related to the low survival rate of PDAC patients. MiR-940 exerted its effect by targeting MyD88.
25723115 Demonstration of the MYD88 L265 mutation is a valuable tool for the diagnosis of Waldenstrom macroglobulinemia/lymphoplasmacytic lymphomas
25722298 Polymorphisms in TLR1 (R80T), NOD2 (L1007fsX1), and MYD88 (-938C>A) are associated with predisposition to development of chronic Q fever.
25691060 Authors demonstrated that MyD88 lies upstream of BLT2 in LPS-potentiated invasiveness and that this 'MyD88-BLT2' cascade mediates activation of NF-kappaB and the synthesis of IL-6 and IL-8 critical for the invasiveness and aggression of breast cancer cells.
25621893 MyD88 and CARD9 act in two discrete phases and in two cellular compartments to direct chemokine- and neutrophil-dependent host defense.
25501023 Diffuse large B cell lymphomas relapsing in the CNS lack oncogenic MYD88 and CD79B mutations.
25475726 CXC195 suppresses proliferation and inflammatory response in LPS-induced human hepatocellular carcinoma cells via regulating TLR4-MyD88-TAK1-mediated NF-kappaB and MAPK pathway
25446563 MyD88 or TRIF had been silenced by siRNA.
25389708 Decreased production of IL-1beta in low birth weight newborns was correlated with reduced expression of TLR-4 and MyD88 mRNA.
25375272 beta3-integrin participates by signaling through Y residues located in the C-tail, known to be involved in signaling activity. alphavbeta3-integrin boosts the MYD88-dependent TLR2 signaling and IRAK4 phosphorylation
25371371 Direct inhibition of MYD88(L265P) signalling overcomes CXCL12 triggered survival effects in CXCR4(WHIM) -mutated cells supporting a primary role for this survival pathway in WM.
25360699 TLR4-MyD88 signaling pathway activation or MyD88 activation alone may be a risk factor for poor prognosis in breast cancer.
25359991 analysis of how lymphoma-associated MyD88 mutations are activated via allostery-induced TIR-domain oligomerization
25347427 Oncogenic MYD88 mutation is associated with primary diffuse large B-cell lymphomas of central nervous system.
25344726 delineation of the latter responses identified a narrow repertoire of transcriptional programs affected by loss of MyD88 function or IRAK4 function
25320320 Taken together, these results suggest that Kaposi's sarcoma-associated herpesvirus RTA facilitates the virus to evade innate immunity through the degradation of MyD88, which might be critical for viral latency control.
25320238 by bolstering the IgM(+)IgD(+)CD27(+) B-cell subset, IRAK-4 and MyD88 promote optimal T-independent IgM antibody responses against bacteria in humans.
25299052 Stimulation of TLR4 with LPS promoted tumorigenesis and formed metastatic lesions in liver of nude mice. Moreover, expression of TLR4 and MyD88 as well as invasiveness and migration of the cells could be blocked by TLR4 antagonist.
25295729 miR-155-dependent downregulation of MyD88 inhibits the inflammatory response in macrophage infected by Francisella tularensis
25247317 The findings indicate that oncogenic MYD88 mutations are not significantly implicated in the pathogenesis of the vast majority of double-hit/triple-hit lymphomas.
25216226 Clinicopathologic review suggests that although MYD88 mutated non-lymphoplasmacytic lymphoma small B-cell neoplasms exist, they are very uncommon.
25197661 monoclonal immunoglobulin heavy chain was mutated in most cases, and a high but not omnipresent prevalence of MYD88 L265P mutation was observed, in Waldenstrom's macroglobulinemia.
25175786 Findings suggested that the inreased expression level of MyD88 is closely associated with paclitaxel resistance in A549 lung cancer cells.
25160558 identification of MYD88 L265P mutation might be a new molecular-based biomarker tool to add to the diagnostic and monitoring armamentarium for BNS.
25159121 first case of del(5q) MDS following MGUS IgMk with the MYD88 L256P mutation in which there is coexistence of the markers of the two clonal diseases
25058342 The frustrated host response to Legionella pneumophila is bypassed by MyD88-dependent translation of pro-inflammatory cytokines.
25055137 This study confirms the high prevalence of MYD88 L265P mutation in primary cutaneous diffuse large B-cell lymphoma, leg-type and shows its association with shorter survival
25054155 MyD88 is suppressed by Trichinella spiralis excretory-secretory products via the mannose receptor in human macrophages and in a mouse model of polymicrobial sepsis
24995344 Our results suggest that MyD88 appears to be important for both an optimal immune response to F1-V and in protection against a lethal challenge of Y. pestis CO92 in F1-V vaccinated mice.
24977712 The expression of MyD88 is associated with significantly reduced patient survival and altered microRNA levels; an intact/ functioning TLR4/MyD88 pathway is required for acquisition of the chemoresistant phenotype.
24903481 MYD88 (L265P) mutation may have a role in progression of diffuse large B-cell lymphoma
24895570 This is the first report of high frequency MYD88 L265P mutations in Korean WM patients.
24887488 Taken together, the hotspot mutations of IDH1, IDH2, DNMT3A, and MYD88 gene were absent in CRC. Aberrant mRNA expression of IDH1, DNMT3A, and MYD88 gene might be actively involved in the development of CRC.
24859878 Gamma heavy chain disease lacks the MYD88 L265p mutation associated with lymphoplasmacytic lymphoma.
24828863 Data indicate that myeloid differentiation factor 88 (MYD88) may represent an adverse prognostic marker for lymphoplasmacytic lymphoma/Waldenstrom macroglobulinemia (LPL/WM).
24782504 TLR/MYD88 mutations identify a population of young Chronic lymphocytic leukemia patients with favorable outcome.
24622324 Sp1 is an important transcription factor that regulates proliferation and survival of WM cells independent of MYD88 pathway activation
24603331 Suggest elevated MyD88 may facilitate hepatocellular carcinoma metastasis by promoting epithelial-mesenchymal transition and tumor-initiating capabilities via PI3-K/Akt pathway.
24573383 discusses the role of MYD88 L265P mutations as well as targets beyond MYD88 in the setting of pathogenesis and development of future rational therapeutic trials focusing on patients diagnosed with Waldenstrom's Macroglobulinemia [review]
24553177 Somatic mutations in MYD88 and CXCR4 are important determinants of clinical presentation and impact overall survival in WM.
24509637 the potential for peripheral blood MYD88 L265P DeltaCt use in the diagnosis and management of Waldenstrom's Macroglobulinemia patients
24444466 CD79B and MYD88 mutations are associated with an older age at onset in diffuse large b-cell lymphoma with a significant overlap, which did not affect the outcome of the disease.
24366360 Mutations in MYD88 is associated with Waldenstrom macroglobulinemia.
24363429 Yersinia-induced apoptosis of human macrophages involves caspase-3-dependent cleavage of MyD88. It is split at D135 in 2 fragments, 1 with the death domain, the other the Toll-IL-1R domain.
24316379 these studies suggest that not only the loss of protein expression but also the defect of Myddosome formation couldcause IRAK4 and MyD88 deficiency syndromes.
24285099 MyD88 is shown in certain cases to play an antitumoral role through modulation of the immune response. These findings present a new dual function model for MyD88 implication in carcinogenesis making it a potential therapeutic target in cancer.
24265315 Data indicate that TcpB (Q8YF5, BtpA/Btp1) interacts with MAL, MyD88, and TLR4 but interferes only with the MAL-TLR4 interaction.
24253023 results suggest that MYD88 mutations, and to a lesser extent CD79B mutations, are important drivers of lymphomagenesis in PTL
24224040 Results suggest that the L265P mutation of the MYD88 gene is involved in the majority of Waldenstrom's macroglobulinemia.
24204290 MyD88S mRNA levels are regulated by the SF3A and SF3B mRNA splicing complexes, and these mRNA splicing complexes function with TLR signaling to regulate MyD88S production
24189845 MyD88 polymorphism rs7744 was significantly associated with the development of UC and that this polymorphism may be associated with the response to treatment therapies for UC.
24153350 the absence of the MyD88 L265P somatic mutation in the Sjogren's syndrome patients
24143223 Helicobacter pylori cag pathogenicity island (cagPAI) involved in bacterial internalization and IL-8 induced responses via NOD1- and MyD88-dependent mechanisms in human biliary epithelial cells
24142728 Data suggest that progesterone can inhibit the Toll-like receptor 4 (TLR4)-MyD88-dependent signaling pathway signaling pathway in pre-eclampsia (PE) significantly and benefit for the pregnancy.
24113472 Associations of cytogenetic aberrations and mutations emerged:(1) SF3B1mut with del(11q), (2) NOTCH1mut and FBXW7mut with trisomy 12 and nearly exclusiveness of SF3B1mut, (3) MYD88mut with del(13q) sole and low frequencies of SF3B1mut, NOTCH1mut, FBXW7mut
24072850 the MYD88 (L265P) mutation is an independent predictor of progression of IgM-monoclonal gammopathy of undetermined significance to lymphoproliferative disorders
24067789 MyD88 rs6853 is associated with resistance to pulmonary tuberculosis.
24019529 novel residues of the TIR domain that are crucially involved in MyD88 homodimerization and TLR signaling in immune cells.
23976989 Athough MYD88 RNA expression was increased in patients with myelodysplastic syndromes, no MYD88 mutations were detected.
23955458 Although not entirely specific, MYD88 L265P is a useful adjunct for bone marrow diagnosis in separating lymphoplasmacytic lymphoma from other small B-cell lymphomas and plasma cell myeloma.
23941760 required, in combination with TRIF, for TLR4-mediated proinflammatory dendritic cell differentiation
23836557 Mutation in MYD88 (L265P) supports the survival of lymphoplasmacytic cells by activation of Bruton tyrosine kinase in Waldenstrom macroglobulinemia
23802631 PSP has an immunoregulatory effect through regulation of the TLR4-TIRAP/MAL-MyD88 signaling pathway.
23786414 Biologically relevant levels of mixed AFs elicited early immune modulation in human PBMCs. qRT-PCR results showed several folds increase of MyD88, TLR2, TLR4 and CD14 transcripts in PBMCs
23728346 our data reveal a differential, but inflammation-independent, requirement for Mal and MyD88 during TLR2-promoted gastric tumourigenesis.
23713977 The blockade of either MyD88 or NF-kappaB, but not TLR4, attenuated Hb-induced HIF activity.
23712403 Studies indicate structural information of interactions in and within key orchestrators of the Toll-like receptor (TLR) pathway, such as MyD88.
23666053 MyD88 variants and specifically the -938A/ 1944G haplotype confers susceptibility to sarcoidosis.
23633945 results indicate that miR-21 is upregulated during hepatitis C virus infection and negatively regulates IFN-alpha signaling through MyD88 and IRAK1
23549880 Myeloid differentiation factor 88 promotes growth and metastasis of human hepatocellular carcinoma.
23532735 The discovery of MYD88 L265P mutation may contribute to a better understanding of the physiopathogeny of Waldenstrom macroglobulinemia.
23497717 overexpression of TLR7 MyD88-dependent signaling molecules may be a common pathogenic mechanism for both adult-onset Still's disease and systemic lupus erythematosus
23460645 Identification of binding sites for myeloid differentiation primary response gene 88 (MyD88) and Toll-like receptor 4 in MyD88 adapter-like (Mal).
23446312 MYD88 L265P is a marker highly characteristic of, but not restricted to, Waldenstrom's macroglobulinemia.
23419703 the results of our study suggest that there is a defect of TIRAP and MyD88 proteins in B-CLL lymphocytes.
23381138 Data found that UBE2O acts to disrupt the IL-1beta-induced association of TRAF6 with MyD88.
23380077 MYD88 may be crucial for lymphoma progression, independent of MYD88 L265P mutation.
23355535 MYD88 (L265P) is associated with greater disease burden and higher risk of disease progression.
23321251 MYD88 L265P may be an early oncogenic event in Waldenstrom macroglobulinemia pathogenesis.
23269203 MyD88 is required for pathogenesis of spontaneous autoimmune encephalomyelitis in proteolipid protein TCR3 transgenic SJL mice.
23255009 Experimental and natural infections in MyD88- and IRAK-4-deficient mice and humans.
23235763 Data indicate that MYD88 overexpression might be a feature of many solid cancers.
23186691 Myd88 might play an important role in the inflammatory response after human traumatic brain injury (TBI).
23136947 results suggest TLR adaptor molecules knockdown, such as MyD88 or TRAM, can decrease IL-6 and IL-8 mRNA and increase CXCL12 mRNA expression in HGF and HPDLF.
23013250 Data suggests that BPDNC cases do not carry amutationaffecting toll like receptor/interleukin 1 receptor activity of MYD88 protein
23002119 IgM(+)IgD(+)CD27(+) but not switched B cells were strongly reduced in MYD88-, IRAK-4-, and TIRAP-deficient patients, but not UNC-93B-deficient patients.
22992740 Data indicate that R753Q TLR2 showed impaired tyrosine phosphorylation, dimerization with TLR6 and MyD88 recruitment.
22985132 Findings suggest that the TLR4/MyD88 signaling pathway is associated with the survival of patients with ovarian epithelial cancers (OECs), and that MyD88 is an independent prognostic predictor in patients with OECs.
22964479 anti-beta(2)GPI/beta(2)GPI complex induced TF and TNF-alpha expression involving both TLR4/MyD88 and TLR4/TRIF signaling pathways and TLR4 and its adaptors might be molecular targets for therapy of antiphospholipid syndrome
22944768 MYD88 L265P mutation was strongly associated with Waldenstrom macroglobulinemia and lymphoplasmacytic lymphomas.
22931316 MYD88 L265P is a commonly recurring mutation in patients with Waldenstrom's macroglobulinemia that can be useful in differentiating Waldenstrom's macroglobulinemia and non-IgM LPL from B-cell disorders that have some of the same features.
22896623 Reanalysis of the array data set identified myeloid differentiation primary response protein 88 (MYD88) in addition to IRAK1 as a potential target of Kaposi's sarcoma-associated herpesvirus microRNAs.
22848400 EM-163 prevents MyD88 from mediating downstream signaling.
22837180 Our study provides new insights into the molecular tumorigenesis of PCNSL and identifies novel genetic alterations in this disease, especially MYD88 and TBL1XR1 mutations activating the NF-kappaB signaling pathway.
22808296 The present study failed to find any mut-ation in MYD88, CARD11 or CD79B in ocular MALT lymphoma.
22739766 antiinflammation effect of human placental multipotent mesenchymal stromal cells is mediated, at least in part, by prostaglandin E2 via a myeloid differentiation primary response gene 88-dependent pathway
22685567 Data indicate that MyD88 works together with the IL-1/IL-18 receptors, can interact with two distinct sorting adaptors, TRAM and Mal, in a conserved manner.
22673208 study demonstrated that MyD88-TIR directly binds to TLR2-TIR and two isolated sites in the MyD88-TIR mediate direct interactions with TLR2-TIR
22640364 data indicate that MYD88 is deregulated in a small subset of patients with MALT lymphoma
22565171 MyD88 is an essential factor for antibacterial immunity and more broadly for anti-infectious immunity.
22541070 Study shows that DICER1 deficit or Alu RNA exposure activates the NLRP3 inflammasome and triggers TLR-independent MyD88 signaling via IL18 in the retinal pigmented epithelium and is implicated in geographic atrophy.
22533866 Univariate and multivariate analyses revealed that MyD88 expression was an independent prognostic factor for disease-free survival and overall survival for epithelial ovarian carcinoma
22495176 MYD88 somatic mutation is a genetic feature of primary cutaneous diffuse large B-cell lymphoma, leg type
22474023 the D299G polymorphism compromises recruitment of MyD88 and TRIF to TLR4 without affecting TLR4 expression, TLR4-MD2 interaction, or LPS binding, suggesting that it interferes with TLR4 dimerization
22332739 protein kinase, DNA-activated catalytic polypeptide (PRKDC), was confirmed to play a role in MyD88-induced IFNA2 activation and IL-8 secretion
22295065 the requirement of TLR2/MyD88/NF-kappaB pathway (first signal) and ROS/potassium efflux (second signal) for NLRP3/ASC inflammasome formation, leading to caspase-1 activation and subsequent IL-1beta release during RSV infection
22288587 peptides containing ITIM-like sequences of IREM-1 (CD300F) differentially regulate MyD88 and TRIF-mediated TLR signalling
22250084 epidermal growth factor receptor tyrosine phosphorylates MUC1, leading to an increase in its association with TLR5, thereby competitively and reversibly inhibiting recruitment of MyD88 to TLR5 and downstream signaling events.
22221660 Findings suggest that TLR2, TLR4, TLR9, MyD88 or MAL/TIRAP genes are not involved as risk factors for pulmonary tuberculosis (TB) in Colombian population.
22219328 MyD88 independently regulates monocyte activation and motility.
22158417 The death domain-containing protein Unc5CL is a novel MyD88-independent activator of the pro-inflammatory IRAK signaling cascade.
22095710 TLR2/TLR4 ligand biglycan enhances antigen-specific T cell priming via MyD88 and Toll-like receptor adapter molecule (TRIF) pathways, triggering autoimmune perimyocarditis in transgenic mice.
22043923 TLR9/MyD88-mediated signalling was regulated mainly by SH2-containing tyrosine phosphatase 1 (SHP-1), which could be activated by CD300a or CD300f.
22020631 Activating L265P mutations of the MYD88 gene are common in primary central nervous system lymphoma.
21991928 Data indicates that somatic mutation of MYD88 is rare in acute leukemias and multiple myelomas.
21956671 C. butyricum activates TLR2-mediated MyD88-independent signaling pathway in human epithelial cells
21949112 Suggest that Gnia2 is involved in endothelial TLR pathways along a signaling cascade that is distinct from MyD88.
21897371 results suggest that MyD88 degradation driven by the Smad6-Smurf pathway is a novel mechanism for TGF-beta1-mediated negative regulation of MyD88-dependent pro-inflammatory signalling
21809339 show that hBD3 reduces NF-kappaB signaling in cells transfected with MyD88 or TRIF
21804016 We showed that the intermediary domain peptide of MyD88 signaling of MyD88-dependent TLR receptors as well as IL-1R
21792053 These studies establish that MyD88 but not Trif signaling plays a critical role in mediating cardiac dysfunction, systemic inflammation, and mortality during polymicrobial sepsis
21654189 Data showed that the mechanisms responsible for IDO regulation primarily involve MyD88 signaling in synovial fibroblasts, as demonstrated by siRNAmediated knockdown of MyD88.
21646294 Notably, among MyD88-dependent Toll-like receptors (TLR), only stimulation via TLR1/2 consistently educates spleen dendritic cells with gut-homing imprinting capacity.
21640812 These data indicate that the Yersinia pestis TIR-domain protein (YPO1883) forms dimers and interacts with the human adaptor protein MyD88.
21621419 Results show that P2X7 activated a NF-kappaB - but not an IFN-beta-dependent luciferase reporter gene in HEK293T cells, and that silencing of MyD88 almost abolished the NF-kappaB activation induced by P2X7.
21606507 the interaction of ABIN1 with polyubiquitin is required to limit the activation of TLR-MyD88 pathways and prevent autoimmunity
21536801 Data indicate that CD300F is an active regulator of TLR-mediated macrophage activation through association with SHP-1 involving MyD88 and/or TRIF.
21525878 A single nucleotide polymorphism in the 3'-untranslated region of MyD88 gene is associated with Buerger disease but not with Takayasu arteritis in Japanese
21383499 A composite MyD88/CD40 switch synergistically activates dendritic cells for enhanced antitumor efficacy.
21325272 aggregates, and thus these foci appear to be "Myddosomes." The MyD88 S34Y loss-of-function mutant demonstrates how proper cellular localization of MyD88 to the Myddosome is a feature required for MyD88 function
21273385 Mycobacterial hypersensitivity pneumonitis requires TLR9-MyD88 in lung CD11b+ CD11c+ cells
21257927 Fas induces KC release by a mechanism requiring MyD88, mitogen-activated protein kinases, and likely activator protein-1
21248248 MyD88 is essential in restricting Toll-like receptor (TLR)3 signaling, thereby protecting the host from unwanted immunopathologies associated with the excessive production of interferon (IFN)-beta.
21179087 MYD88 signalling pathway is integral to the pathogenesis of activated B-cell-like subtype of diffuse large B-cell lymphoma
21113489 MyD88 adaptor protein expression in endothelial cells is stimulated by cell-surface receptor binding extracellular DNA fragments.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20966070 Two variants found in the MyD88 death domain, S34Y and R98C, showed severely reduced NF-kappaB activation due to reduced homo-oligomerization and IRAK4 interaction
20957750 TLR3-mediated IFN-beta gene induction is negatively regulated by the TLR adaptor MyD88 adaptor-like
20941850 MyD88 plays what we believe to be a crucial direct role in RAS signaling, cell-cycle control, and cell transformation.
20937539 HBx stimulates the production of IL-6 in a MyD88-dependent manner, indicating that parenchymal liver cells are an additional source of high levels of IL-6 in the HBV-infected liver microenvironment.
20880684 Sulphoraphane inhibited the expressions of intercellular adhesion molecule-1 and vascular cell adhesion molecule-1 through MyD88-dependent toll-like receptor-4 pathway in cultured endothelial cells.
20837465 Study reveals not only that SQSTM1 and HDAC6 are important determinants of aggregated localization of MyD88.
20824098 MyD88-deficient mice fed a high-fat diet had increased risk of diabetes.
20817868 a potential mechanism for steroid resistance in asthma is the activation of MyD88-dependent pathways in macrophages that are triggered by IL-27 and IFN-gamma
20805788 Data demonstrate that during bacterial infection, newborns amplify the TLR2-MyD88 pathway in G+ bacterial infection and the TLR4/MD2/MyD88 pathway in G- bacterial infection, implicating the innate immune pathway in response to bacterial infection.
20802145 viral inhibitor peptide of TLR4 possibly represents a surface domain of A46 that specifically inhibits TLR4 by masking critical binding sites on MyD88 adaptor-like and TRIF-related adaptor molecule
20681284 Yiqi huoxue recipe block the high expression of TLR4, and also influence the MyD88-dependent signaling pathway of TLR4 in HUVECs.
20676093 MyD88 controls a B cell-intrinsic, TIR-independent, TACI-dependent pathway for immunoglobulin diversification
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20485341 the crystal structure of the MyD88-IRAK4-IRAK2 death domain (DD) complex, which surprisingly reveals a left-handed helical oligomer that consists of 6 MyD88, 4 IRAK4 and 4 IRAK2 DDs
20463618 Observational study of gene-disease association. (HuGE Navigator)
20448286 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20433840 Cellular compartmentalization of MyD88 signals in the intestine allow the maintenance of host defense and prevent deleterious inflammatory responses.
20410269 The authors report that MyD88 inhibited hepatitis B virus replication in HepG2.2.15 cells and in a mouse model.
20406964 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20306472 SARM-mediated inhibition may not be exclusively directed at TRIF or MyD88, but that SARM may also directly inhibit MAPK phosphorylation
20219467 miR-155 can negatively regulate inflammation by targeting a key adaptor molecule MyD88 in inflammatory pathways.
20197549 MyD88-dependent TLR4 signaling is selectively impaired in alveolar macrophages from asymptomatic HIV+ persons
20167866 TLR2 cooperates with MyD88, PI3K, and Rac1 in lipoteichoic acid-induced cPLA2/COX-2-dependent airway inflammatory responses
20145615 High expression of myeloid differentiation factor 88 is associated with colorectal cancer.
20145198 HIV-1 Vpr-induced IL-6 production depends on the activation of NFkappaB and the involvement of C/EBP-beta, TLR4, and MyD88
19950169 Data demonstrate that PKC-alpha is induced by several MyD88-dependent TLR/IL-1R ligands and regulates cytokine expression in human and murine DC.
19948740 Data show that AIP1 is a novel GTPase-activating protein for Arf6, a small GTPase regulating cellular PIP(2) production and formation of the TLR4-TIRAP-MyD88 complex.
19940113 Data suggest that TILRR is an IL-1RI co-receptor, which associates with the signaling receptor complex to enhance recruitment of MyD88 and control Ras-dependent amplification of NF-kappaB and inflammatory responses.
19917706 ERK1/2 activation and IL-8 secretion responses in human intestinal epithelial cells infected with T. gondii were shown to be MyD88 dependent
19913121 Observational study of gene-disease association. (HuGE Navigator)
19826413 TLR4/MyD88 signaling supports ovarian cancer progression and chemoresistance, promoting immune escape.
19786094 identify IKK alpha kinase and alkaline phosphatase as negative regulators of IRF-5 activity in MyD88 pathway
19779605 SOCS2 is required for appropriate TLR4 signaling in maturating human DCs via both the MyD88-dependent and -independent signaling pathway
19753301 analysis of inhibitors of MyD88-dependent proinflammatory cytokine production
19745833 Study showed that TLR polymorphisms, and TLR9 and MYD88 haplotypes are related to the development of HL.
19745833 Observational study of gene-disease association. (HuGE Navigator)
19656901 dysregulation of TLR4-triggered MyD88- and TRIF-dependent signaling pathways and increased expression of negative regulators of TLR signaling in endotoxin-tolerant human monocytes.
19619129 Epithelial responses to flagellin are potentiated by IFNgamma, most likely mediated by increased MyD88 expression.
19592493 analysis of an oligomeric signaling platform formed by the Toll-like receptor signal transducers MyD88 and IRAK-4
19548630 The inhibition of NF-kappaB was also observed in a cell line cotransfected with MyD88 and TLR4 suggesting that the attenuation of NF-kappaB by atorvastatin occurred in a MyD88 dependent fashion.
19543401 Observational study of gene-disease association. (HuGE Navigator)
19506249 The present study describes the solution structure of the MyD88 TIR domain.
19494325 Lipopolysaccharide stimulates platelet secretion and potentiates platelet aggregation through a TLR4/MyD88- and cGMP/PKG-dependent pathway
19488045 This study indicated that statistically significant higher protein and mRNA levels of the myd88 in frontal corte in bipolar disorder.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
19297619 TLR9 and MyD88 are essential to initiate IL12 and IFNgamma responses and favor host hyperresponsiveness to TLR agonists resulting in overproduction of proinflammatory cytokines and the sepsis-like symptoms of acute malaria.
19265123 At endogenous levels, positive and negative regulators interact with MyD88 in a timely and orderly manner to differentially mediate NF-kappa B activity through the course of signaling from initiation to prolongation, and to repression.
19257978 Data show that the recombinant plasmid pIRES-tPA-OprF-MyD88 has been successfully constructed and tPA-OprF and MyD88 protein can be highly expressed in transfected cells.
19254290 Observational study of gene-disease association. (HuGE Navigator)
19167362 Residues 110-120, which form a C-terminal extra helix in MyD88 are required for IRAK-4 recruitment; it provides a straightforward explanation for the negative regulation of innate immune responses mediated by MyD88s.
19124728 Purified human herpesvirus type 4-encoded deoxyuridinetriphosphatase (dUTPase) requires the recruitment of the adaptor molecule MyD88 to activate human nuclear factor (NF)-kappa B through Toll-like receptor 2.
19120481 patients with congenital deficiencies show enhanced susceptibility to pyogenic bacteria such as Staphylococcus or Pneumococcus
19006693 IRAK-4-, MyD88-, and UNC-93B-deficient patients did not display autoreactive antibodies in their serum or develop autoimmune diseases, suggesting that IRAK-4, MyD88, and UNC-93B pathway blockade may thwart autoimmunity in humans.
18987746 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18802114 The MyD88-dependent Toll-like receptor 2 signaling pathway mediates lipoteichoic acid-induced heme oxygenase-1 expression in human cultured tracheal smooth muscle cells.
18782768 pneumolysin selectively induced expression of MKP1 via a TLR4-dependent MyD88-TRAF6-ERK pathway, which inhibited the PAK4-JNK signaling pathway,leading to up-regulation of MUC5AC mucin production
18776126 activation of the TLR9/MyD88 pathway by common antigens may affect the severity of IgAN
18771998 Toll-like receptor signaling 4 may induce placental corticotropin-releasing hormone expression through myeloid differentiation primary response gene (MyD88).
18768833 Myd88-deficient transgenic T cells do not expand effectively in response to lymphocytic horiomeningitis infection but develop effector functions and differentiate into long-lived memory cells.
18719610 MyD88 is important in IL-6 and MMP-1 expressions in both acutely UV-irradiated skin and in chronically sun-exposed human skin
18703508 germinating but not resting conidia of A. fumigatus results in interleukin (IL)-8 synthesis that is controlled by phosphatidylinositol 3-kinase, p38 MAPK, and ERK1/2. MyD88 pathway is activated by A. fumigatus and leads to NF-kappaB activation
18669862 study of MyD88 deficient children who had life-threatening pyogenic bacterial infection but normal resistance to other microbes;MyD88-dependent TLRs & IL-1Rs are essential for immunity to some pyogenic bacteria but redundant for defense to most infections
18581201 These results suggest that TLR signaling is mediated via MyD88-independent pathways as well as MyD88-dependent pathways in human adipose tissue-derived mesenchymal stem cells.
18571728 PTP1B is a physiological negative regulator of TLR signaling via suppression of both MyD88- and TRIF-dependent production of proinflammatory cytokine and IFN-beta in macrophages.
18541719 microfilariae interfere with monocyte-derived DC function by altering TLR3 and TLR4 expression and interfering with both MyD88-dependent signaling and a pathway that ultimately diminishes NF-kappaB activity
18539711 Observational study of gene-disease association. (HuGE Navigator)
18523439 TLR4 may participate in cerebral ischemic injury through an MyD88-independent signal pathway.
18503546 These results demonstrate that downregulation of IRAK-4 requires activation of the MyD88-dependent pathway and that the death domains of both MyD88 and IRAK-4 are important for this downregulation.
18458086 scaffold protein MyD88 as the link coupling TLR2,4 to PKCepsilon recruitment, phosphorylation, and downstream signaling.
18325643 Observational study of gene-disease association. (HuGE Navigator)
18292575 MyD88 forms a complex with focal adhesion kinase (FAK) and myelin and T-cell associated maturation protein (MAL) in bacterial lipopolyssaccharide and protein I/II-activated fibroblast-like synoviocytes from rheumatoid arthitis patients.
18195069 EDN can activate myeloid DCs by triggering the Toll-like receptor (TLR)2-myeloid differentiation factor 88 signaling pathway
18086890 Nitric oxide (NO) has a potential to retard induction of MyD88-dependent signaling events through the reversible and oxidative modification by NO.
18070982 TRAF6 is involved but with different mechanisms in MyD88-induced activation of NF-kappaB.
17940625 MyD88 has a role in chemoresistance to paclitaxel in epithelial ovarian cancer
17935950 a role for NF-kappaB activation in the inhibition of HBV replication and suggest a novel mechanism for the inhibition of HBV replication by MyD88 protein.
17920759 MyD88dn reduced proliferation and induced apoptosis of MT2 cells
17905570 MyD88, IRAK1 and TRAF6 proteins are crucial early mediators for the IL-1beta-induced MMP-13 regulation through MAPK pathways and AP-1 activity.
17583698 Distinct roles for the TIR and non-TIR regions in the subcellular localization and signaling properties of MyD88.
17548806 ST2825 interfered with recruitment of IRAK1 and IRAK4 by MyD88, causing inhibition of IL-1beta-mediated activation of NF-kappaB transcriptional activity.
17513785 TLR4 engagement by lipopolysaccharide completely fails to activate the MyD88-independent signaling pathway in human neutrophils, a feature of their terminal maturation.
17507480 Data show that single-stranded RNA of HIV-1 encodes multiple uridine-rich Toll-like receptor 7/8 ligands that induce MyD88-dependent plasmacytoid dendritic cell and monocyte activation, as well as accessory cell-dependent T-cell activation.
17507369 IL-1RAcP, MyD88, and IRAK-4 are the stable components of the endogenous type I interleukin-1 (IL-1) receptor signaling complex
17363736 Inhibition of the MyD88 and TRAF6 adaptor proteins of the TLR pathway blocked not only B7-H1 expression induced by TLR ligands but also that mediated by IFN-gamma
16644730 MyD88 bridges TLR5 engagement to PI3K activation in response to flagellin
16517750 TGF-beta-activated kinase 1, TNF receptor-associated factor 6, and MyD88 are important signal transducers in H. pylori-infected human epithelial cells
16517734 By manipulating levels of MyD88 splicing, proinflammatory signaling through the IL-1R has been shown to be diminished, both in cell culture and in mouse liver
16293622 The adaptor MyD88 is specifically recruited to the bacterial or inclusion membrane during a productive infection with chlamydia.
16203735 Monarch-1 associates with IRAK-1 but not MyD88, resulting in the blockage of IRAK-1 hyperphosphorylation
15849357 Analysis of a three-dimensional docking model of the TIR-TIR interaction between MyD88 and IL1RAcP
15845500 activation of TLR4-MyD88-dependent and -independent signaling pathways by endotoxins determined by structure of the endotoxin
15760459 BCG induced transcription and secretion of the chemokine CXCL8, by signalling through Toll-like receptors TLR2 and TLR4, in conjunction with myeloid differentiation factor 88 (MyD88)in neutrophils
15623538 TGF-beta1 can specifically interfere with TLR2, -4, or -5 ligand-induced responses involving the adaptor molecule MyD88 (myeloid differentiation factor 88) but not the TRAM/TRIF signaling pathway
15361868 TLR-mediated IFN-alpha induction requires the formation of a complex consisting of MyD88, TRAF6 and IRF7 as well as TRAF6-dependent ubiquitination.
14630816 MyD88 and Mal/TIRAP are essential for LPS-induced I kappa B alpha phosphorylation, NF-kappa B activation, and interleukin 6 (IL-6) or IL-8 production in fibroblasts and endothelial cells in a pathway that also requires IKK2.
14573621 Mice deficient in Toll-like receptor (TLR)-2, TLR-4, TLR-2/TLR-4, and myeloid differentiation factor 88 produced the same amount of IL-6 as macrophages from normal mice.
12885415 an LPS-inducible splice variant of MyD88, MyD88(S), is not able to activate NF-kB, and functions as a dominant negative inhibitor of TLR/IL-1R-induced NF-kB activation. MyD88(S) still allows JNK phosphorylation and AP-1-dependent reporter gene induction
12865424 saturated and polyunsaturated fatty acids reciprocally modulate the activation of TLR4 and its downstream signaling pathways involving MyD88/IRAK/TRAF6 and PI3K/AKT.
12531807 The MyD88 transduction signaling pathway is involved in endothelial activation by antiphospholipid antibodies. Delta MyD88 significantly abrogates antibody-induced as well as IL-1- or LPS-induced NF-kappa B activation.
12391239 Although expression levels of MyD88 mRNA and protein are normal in lipopolysaccharide (LPS)-tolerant monocytes, MyD88 fails to be recruited to TLR4 in response to LPS restimulation.
11854210 IFN-gamma markedly up-regulated CD14 and MyD88 but not TLR4 protein and MD-2 mRNA expression in human gingival fibroblasts.

AA Sequence

MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADP      1 - 70
TGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPR     71 - 140
TAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASE    141 - 210
LIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPC    211 - 280
TKSWFWTRLAKALSLP                                                          281 - 296
//

Text Mined References (332)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27079437 2016 Inflammation in gastric cancer: Interplay of the COX-2/prostaglandin E2 and Toll-like receptor/MyD88 pathways.
26900675 2016 PREVALENCE OF MYD88 L265P MUTATION IN HISTOLOGICALLY PROVEN, DIFFUSE LARGE B-CELL VITREORETINAL LYMPHOMA.
26752547 2016 Frequent MYD88 L265P and CD79B Mutations in Primary Breast Diffuse Large B-Cell Lymphoma.
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26719415 2016 Deubiquitinase CYLD acts as a negative regulator for bacterium NTHi-induced inflammation by suppressing K63-linked ubiquitination of MyD88.
26711529 2016 Screening of posttranscriptional regulatory molecules of I?B-?.
26669856 2015 Nontypeable Haemophilus influenzae-Induced MyD88 Short Expression Is Regulated by Positive IKK? and CREB Pathways and Negative ERK1/2 Pathway.
26600481 2015 Expression and significance of myeloid differentiation factor 88 in non-small cell lung carcinoma and normal paracancerous tissues.
26592460 2016 SARM modulates MyD88-mediated TLR activation through BB-loop dependent TIR-TIR interactions.
26563875 2015 Fibronectin fragment-induced expression of matrix metalloproteinases is mediated by MyD88-dependent TLR-2 signaling pathway in human chondrocytes.
26548862 2016 In Vitro Reconstitution of the Toll/Interleukin-1 Receptor (TIR) Domain Complex Between TLR5/6 and Myd88.
26468534 2015 Kaposi's Sarcoma-Associated Herpesvirus Reduces Cellular Myeloid Differentiation Primary-Response Gene 88 (MyD88) Expression via Modulation of Its RNA.
26466961 2015 Lipopolysaccharide Regulation of Intestinal Tight Junction Permeability Is Mediated by TLR4 Signal Transduction Pathway Activation of FAK and MyD88.
26388135 2015 High prevalence of the MYD88 mutation in testicular lymphoma: Immunohistochemical and genetic analyses.
26363072 2015 Cardiac RNA induces inflammatory responses in cardiomyocytes and immune cells via Toll-like receptor 7 signaling.
26294719 2015 Prognostic relevance of MYD88 mutations in CLL: the jury is still out.
26261595 2015 Significance of TLR4/MyD88 expression in breast cancer.
26244327 2015 MYD88 Mutations and Response to Ibrutinib in Waldenström's Macroglobulinemia.
26230596 2015 Significance of MYD88 L265P Mutation Status in the Subclassification of Low-Grade B-Cell Lymphoma/Leukemia.
26223974 2015 MiRNA-149 modulates chemosensitivity of ovarian cancer A2780 cells to paclitaxel by targeting MyD88.
26159625 2015 Bing-Neel syndrome: Two unexpected cases and a review of the literature.
26099629 2015 Lack of myeloid differentiation primary response protein MyD88 L265P mutation in primary cutaneous marginal zone lymphoma.
26075815 2015 Association of Polymorphisms in IRAK1, IRAK4 and MyD88, and Severe Invasive Pneumococcal Disease.
25978699 2015 MYD88 expression and L265P mutation in mature B-cell non-Hodgkin lymphomas.
25969543 2015 Activation of MyD88-dependent TLR1/2 signaling by misfolded ?-synuclein, a protein linked to neurodegenerative disorders.
25900979 2015 High frequency of MYD88 mutations in vitreoretinal B-cell lymphoma: a valuable tool to improve diagnostic yield of vitreous aspirates.
25886387 2015 Rare variants in MYD88, IRAK4 and IKBKG and susceptibility to invasive pneumococcal disease: a population-based case-control study.
25877355 2015 Involvement of TLR2-MyD88 in abnormal expression of miR-146a in peripheral blood monocytes of patients with chronic hepatitis C.
25870959 2015 Role of Toll-like receptor/MYD88 signaling in neurodegenerative diseases.
25819228 2015 MYD88 L265P and CXCR4 mutations in lymphoplasmacytic lymphoma identify cases with high disease activity.
25816840 2015 Allele-specific PCR is a powerful tool for the detection of the MYD88 L265P mutation in diffuse large B cell lymphoma and decalcified bone marrow samples.
25768255 2015 MyD-88 L265P mutations are present in some cases of vitreoretinal lymphoma.
25766528 2015 MiR-940 inhibited pancreatic ductal adenocarcinoma growth by targeting MyD88.
25723115 2015 MYD88 (L265P) somatic mutation in marginal zone B-cell lymphoma.
25722298 2015 Genetic Variation in Pattern Recognition Receptors and Adaptor Proteins Associated With Development of Chronic Q Fever.
25691060 2015 Myeloid differentiation primary response gene 88-leukotriene B4 receptor 2 cascade mediates lipopolysaccharide-potentiated invasiveness of breast cancer cells.
25621893 2015 Compartment-specific and sequential role of MyD88 and CARD9 in chemokine induction and innate defense during respiratory fungal infection.
25501023 2014 Diffuse large B cell lymphomas relapsing in the CNS lack oncogenic MYD88 and CD79B mutations.
25475726 2015 CXC195 suppresses proliferation and inflammatory response in LPS-induced human hepatocellular carcinoma cells via regulating TLR4-MyD88-TAK1-mediated NF-?B and MAPK pathway.
25446563 2014 Anesthetic agent propofol inhibits myeloid differentiation factor 88-dependent and independent signaling and mitigates lipopolysaccharide-mediated reactive oxygen species production in human neutrophils in vitro.
25416956 2014 A proteome-scale map of the human interactome network.
25389708 2014 Decreased toll-like receptor-4/myeloid differentiation factor 88 response leads to defective interleukin-1? production in term low birth weight newborns.
25375272 2014 The epithelial ?v?3-integrin boosts the MYD88-dependent TLR2 signaling in response to viral and bacterial components.
25371371 2015 CXCR4 WHIM-like frameshift and nonsense mutations promote ibrutinib resistance but do not supplant MYD88(L265P) -directed survival signalling in Waldenström macroglobulinaemia cells.
25360699 2014 Prognostic value of myeloid differentiation primary response 88 and Toll-like receptor 4 in breast cancer patients.
25359991 2014 Activation of lymphoma-associated MyD88 mutations via allostery-induced TIR-domain oligomerization.
25347427 2015 Primary diffuse large B-cell lymphomas of central nervous system exhibit remarkably high prevalence of oncogenic MYD88 and CD79B mutations.
25344726 2014 A narrow repertoire of transcriptional modules responsive to pyogenic bacteria is impaired in patients carrying loss-of-function mutations in MYD88 or IRAK4.
25320320 2015 Kaposi's sarcoma-associated herpesvirus-encoded replication and transcription activator impairs innate immunity via ubiquitin-mediated degradation of myeloid differentiation factor 88.
25320238 2014 IRAK-4 and MyD88 deficiencies impair IgM responses against T-independent bacterial antigens.
25299052 2014 Toll-like receptor 4 prompts human breast cancer cells invasiveness via lipopolysaccharide stimulation and is overexpressed in patients with lymph node metastasis.
25295729 2014 Differential expression of microRNAs in Francisella tularensis-infected human macrophages: miR-155-dependent downregulation of MyD88 inhibits the inflammatory response.
25247317 2015 Oncogenic MYD88 mutations are rare events in double-hit B-cell lymphomas.
25216226 2015 MYD88 L265P mutation analysis helps define nodal lymphoplasmacytic lymphoma.
25197661 2014 Clonotypic analysis of immunoglobulin heavy chain sequences in patients with Waldenström's macroglobulinemia: correlation with MYD88 L265P somatic mutation status, clinical features, and outcome.
25175786 2014 MyD88 expression is associated with paclitaxel resistance in lung cancer A549 cells.
25160558 2014 MYD88 L265P mutation contributes to the diagnosis of Bing Neel syndrome.
25159121 2015 Myelodysplastic syndrome with 5q deletion following IgM monoclonal gammopathy, showing gene mutation MYD88 L265P.
25058342 2014 The frustrated host response to Legionella pneumophila is bypassed by MyD88-dependent translation of pro-inflammatory cytokines.
25055137 2014 High frequency and clinical prognostic value of MYD88 L265P mutation in primary cutaneous diffuse large B-cell lymphoma, leg-type.
25054155 2014 Trichinella spiralis excretory-secretory products protect against polymicrobial sepsis by suppressing MyD88 via mannose receptor.
24995344 2014 Multiple roles of Myd88 in the immune response to the plague F1-V vaccine and in protection against an aerosol challenge of Yersinia pestis CO92 in mice.
24977712 2014 The MyD88+ phenotype is an adverse prognostic factor in epithelial ovarian cancer.
24903481 2014 MYD88 (L265P) mutation is an independent prognostic factor for outcome in patients with diffuse large B-cell lymphoma.
24895570 2014 MYD88 L265P mutations are correlated with 6q deletion in Korean patients with Waldenström macroglobulinemia.
24887488 2014 Mutation and expression analysis of the IDH1, IDH2, DNMT3A, and MYD88 genes in colorectal cancer.
24859878 2014 Gamma heavy chain disease lacks the MYD88 L265p mutation associated with lymphoplasmacytic lymphoma.
24828863 2015 MYD88 mutant lymphoplasmacytic lymphoma/Waldenström macroglobulinemia has distinct clinical and pathological features as compared to its mutation negative counterpart.
24782504 2014 Mutations in TLR/MYD88 pathway identify a subset of young chronic lymphocytic leukemia patients with favorable outcome.
24622324 2014 MYD88-independent growth and survival effects of Sp1 transactivation in Waldenstrom macroglobulinemia.
24603331 2014 Enhanced myeloid differentiation factor 88 promotes tumor metastasis via induction of epithelial-mesenchymal transition in human hepatocellular carcinoma.
24573383 2014 MYD88 and beyond: novel opportunities for diagnosis, prognosis and treatment in Waldenström's Macroglobulinemia.
24553177 2014 Somatic mutations in MYD88 and CXCR4 are determinants of clinical presentation and overall survival in Waldenstrom macroglobulinemia.
24509637 2014 Detection of MYD88 L265P in peripheral blood of patients with Waldenström's Macroglobulinemia and IgM monoclonal gammopathy of undetermined significance.
24444466 2014 CD79B and MYD88 mutations in diffuse large B-cell lymphoma.
24366360 2014 The genomic landscape of Waldenstrom macroglobulinemia is characterized by highly recurring MYD88 and WHIM-like CXCR4 mutations, and small somatic deletions associated with B-cell lymphomagenesis.
24363429 2014 Cell death triggered by Yersinia enterocolitica identifies processing of the proinflammatory signal adapter MyD88 as a general event in the execution of apoptosis.
24316379 2014 Functional assessment of the mutational effects of human IRAK4 and MyD88 genes.
24285099 2014 Dual function of MyD88 in inflammation and oncogenesis: implications for therapeutic intervention.
24265315 2014 Mechanism of bacterial interference with TLR4 signaling by Brucella Toll/interleukin-1 receptor domain-containing protein TcpB.
24253023 2014 High prevalence of oncogenic MYD88 and CD79B mutations in primary testicular diffuse large B-cell lymphoma.
24224040 2013 L265P mutation of the MYD88 gene is frequent in Waldenström's macroglobulinemia and its absence in myeloma.
24204290 2013 Limiting of the innate immune response by SF3A-dependent control of MyD88 alternative mRNA splicing.
24189845 2014 The *1244 A>G polymorphism of MyD88 (rs7744) is closely associated with susceptibility to ulcerative colitis.
24153350 2014 Absence of somatic MYD88 L265P mutations in patients with primary Sjogren's syndrome.
24143223 2013 Helicobacter pylori cag pathogenicity island (cagPAI) involved in bacterial internalization and IL-8 induced responses via NOD1- and MyD88-dependent mechanisms in human biliary epithelial cells.
24142728 2013 Role of progesterone in TLR4-MyD88-dependent signaling pathway in pre-eclampsia.
24113472 2014 SF3B1 mutations correlated to cytogenetics and mutations in NOTCH1, FBXW7, MYD88, XPO1 and TP53 in 1160 untreated CLL patients.
24072850 2013 MYD88 (L265P) mutation is an independent risk factor for progression in patients with IgM monoclonal gammopathy of undetermined significance.
24067789 2013 The MyD88 rs6853 and TIRAP rs8177374 polymorphic sites are associated with resistance to human pulmonary tuberculosis.
24019529 2013 Mutational analysis identifies residues crucial for homodimerization of myeloid differentiation factor 88 (MyD88) and for its function in immune cells.
23976989 2013 Overexpression of the toll-like receptor (TLR) signaling adaptor MYD88, but lack of genetic mutation, in myelodysplastic syndromes.
23955458 2013 MYD88 L265P somatic mutation: its usefulness in the differential diagnosis of bone marrow involvement by B-cell lymphoproliferative disorders.
23941760 2014 TLR4-mediated pro-inflammatory dendritic cell differentiation in humans requires the combined action of MyD88 and TRIF.
23836557 2013 A mutation in MYD88 (L265P) supports the survival of lymphoplasmacytic cells by activation of Bruton tyrosine kinase in Waldenström macroglobulinemia.
23802631 2013 A study on the immunomodulation of polysaccharopeptide through the TLR4-TIRAP/MAL-MyD88 signaling pathway in PBMCs from breast cancer patients.
23786414 2013 Biologically relevant doses of mixed aflatoxins B and G up-regulate MyD88, TLR2, TLR4 and CD14 transcripts in human PBMCs.
23728346 2014 Differential role of MyD88 and Mal/TIRAP in TLR2-mediated gastric tumourigenesis.
23713977 2013 Hemoglobin-induced endothelial cell permeability is controlled, in part, via a myeloid differentiation primary response gene-88-dependent signaling mechanism.
23712403 2013 The structural network of inflammation and cancer: merits and challenges.
23666053 2013 Polymorphisms and haplotypes in MyD88 are associated with the development of sarcoidosis: a candidate-gene association study.
23633945 2013 HCV-induced miR-21 contributes to evasion of host immune system by targeting MyD88 and IRAK1.
23549880 2013 Myeloid differentiation factor 88 promotes growth and metastasis of human hepatocellular carcinoma.
23532735 2013 MYD88 L265P mutation in Waldenstrom macroglobulinemia.
23497717 2013 Involvement of TLR7 MyD88-dependent signaling pathway in the pathogenesis of adult-onset Still's disease.
23460645 2013 Identification of binding sites for myeloid differentiation primary response gene 88 (MyD88) and Toll-like receptor 4 in MyD88 adapter-like (Mal).
23453969 2013 IKK?-mediated tumorigenesis requires K63-linked polyubiquitination by a cIAP1/cIAP2/TRAF2 E3 ubiquitin ligase complex.
23446312 2013 MYD88 L265P is a marker highly characteristic of, but not restricted to, Waldenström's macroglobulinemia.
23419703 2013 Aberrant TIRAP and MyD88 expression in B-cell chronic lymphocytic leukemia.
23381138 2013 UBE2O negatively regulates TRAF6-mediated NF-?B activation by inhibiting TRAF6 polyubiquitination.
23380077 2013 MYD88 expression and L265P mutation in diffuse large B-cell lymphoma.
23355535 2013 Prevalence and clinical significance of the MYD88 (L265P) somatic mutation in Waldenstrom's macroglobulinemia and related lymphoid neoplasms.
23321251 2013 MYD88 L265P in Waldenström macroglobulinemia, immunoglobulin M monoclonal gammopathy, and other B-cell lymphoproliferative disorders using conventional and quantitative allele-specific polymerase chain reaction.
23269203 2013 The innate immune adaptor MyD88 is dispensable for spontaneous autoimmune demyelination in a mouse model of multiple sclerosis.
23255009 2012 Experimental and natural infections in MyD88- and IRAK-4-deficient mice and humans.
23235763 Mutational and expressional analyses of MYD88 gene in common solid cancers.
23186691 2013 Enhanced cortical expression of myeloid differentiation primary response protein 88 (Myd88) in patients with traumatic brain injury.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23136947 2013 MyD88 or TRAM knockdown regulates interleukin (IL)-6, IL-8, and CXCL12 mRNA expression in human gingival and periodontal ligament fibroblasts.
23013250 2013 Absence of MYD88 L265P mutation in blastic plasmacytoid dendritic cell neoplasm.
23002119 2012 IgM+IgD+CD27+ B cells are markedly reduced in IRAK-4-, MyD88-, and TIRAP- but not UNC-93B-deficient patients.
22992740 2012 R753Q polymorphism inhibits Toll-like receptor (TLR) 2 tyrosine phosphorylation, dimerization with TLR6, and recruitment of myeloid differentiation primary response protein 88.
22985132 2012 Expression and significance of the TLR4/MyD88 signaling pathway in ovarian epithelial cancers.
22964479 2013 Anti-?(2)GPI/?(2)GPI induced TF and TNF-? expression in monocytes involving both TLR4/MyD88 and TLR4/TRIF signaling pathways.
22944768 2013 IGHV gene features and MYD88 L265P mutation separate the three marginal zone lymphoma entities and Waldenström macroglobulinemia/lymphoplasmacytic lymphomas.
22931316 2012 MYD88 L265P somatic mutation in Waldenström's macroglobulinemia.
22896623 2012 Kaposi's sarcoma-associated herpesvirus microRNAs target IRAK1 and MYD88, two components of the toll-like receptor/interleukin-1R signaling cascade, to reduce inflammatory-cytokine expression.
22848400 2012 Therapeutic inhibition of pro-inflammatory signaling and toxicity to staphylococcal enterotoxin B by a synthetic dimeric BB-loop mimetic of MyD88.
22837180 2012 Recurrent mutations of MYD88 and TBL1XR1 in primary central nervous system lymphomas.
22808296 2012 Mutation analysis of NF-?B signal pathway-related genes in ocular MALT lymphoma.
22739766 2012 Antiinflammation effect of human placental multipotent mesenchymal stromal cells is mediated by prostaglandin E2 via a myeloid differentiation primary response gene 88-dependent pathway.
22685567 2012 TRAM is involved in IL-18 signaling and functions as a sorting adaptor for MyD88.
22673208 2012 Molecular analysis of the binding mode of Toll/interleukin-1 receptor (TIR) domain proteins during TLR2 signaling.
22640364 2012 MYD88 somatic mutations in MALT lymphomas.
22581261 2012 DOCK8 functions as an adaptor that links TLR-MyD88 signaling to B cell activation.
22565171 [Antibacterial immunity in respiratory tract: what role for the myeloid differentiation primary response protein 88 (MyD88) adaptor?].
22541070 2012 DICER1 loss and Alu RNA induce age-related macular degeneration via the NLRP3 inflammasome and MyD88.
22533866 2012 Prognostic significance of MyD88 expression by human epithelial ovarian carcinoma cells.
22495176 2012 MYD88 somatic mutation is a genetic feature of primary cutaneous diffuse large B-cell lymphoma, leg type.
22474023 2012 The Asp299Gly polymorphism alters TLR4 signaling by interfering with recruitment of MyD88 and TRIF.
22332739 siRNA high-throughput kinase library screen identifies protein kinase, DNA-activated catalytic polypeptide to play a role in MyD88-induced IFNA2 activation and IL-8 secretion.
22295065 2012 TLR2/MyD88/NF-?B pathway, reactive oxygen species, potassium efflux activates NLRP3/ASC inflammasome during respiratory syncytial virus infection.
22288587 2012 Synthetic peptides containing ITIM-like sequences of IREM-1 (CD300F) differentially regulate MyD88 and TRIF-mediated TLR signalling through activation of SHP and/or PI3K.
22250084 2012 Membrane-tethered MUC1 mucin is phosphorylated by epidermal growth factor receptor in airway epithelial cells and associates with TLR5 to inhibit recruitment of MyD88.
22221660 2012 Evaluation of Toll-like receptor and adaptor molecule polymorphisms for susceptibility to tuberculosis in a Colombian population.
22219328 2012 Cells exposed to sublethal oxidative stress selectively attract monocytes/macrophages via scavenger receptors and MyD88-mediated signaling.
22158417 2012 The death domain-containing protein Unc5CL is a novel MyD88-independent activator of the pro-inflammatory IRAK signaling cascade.
22155231 2012 The Brucella TIR-like protein TcpB interacts with the death domain of MyD88.
22095710 2011 The proteoglycan biglycan enhances antigen-specific T cell activation potentially via MyD88 and TRIF pathways and triggers autoimmune perimyocarditis.
22043923 2012 CD300a and CD300f differentially regulate the MyD88 and TRIF-mediated TLR signalling pathways through activation of SHP-1 and/or SHP-2 in human monocytic cell lines.
22020631 2011 Activating L265P mutations of the MYD88 gene are common in primary central nervous system lymphoma.
21991928 2012 Absence of MYD88 gene mutation in acute leukemias and multiple myelomas.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21956671 2012 Clostridium butyricum activates TLR2-mediated MyD88-independent signaling pathway in HT-29 cells.
21949112 2011 Heterotrimeric Gi/Go proteins modulate endothelial TLR signaling independent of the MyD88-dependent pathway.
21897371 2011 Smad6-specific recruitment of Smurf E3 ligases mediates TGF-?1-induced degradation of MyD88 in TLR4 signalling.
21809339 2011 Human ?-defensin 3 affects the activity of pro-inflammatory pathways associated with MyD88 and TRIF.
21804016 2011 The role of intermediary domain of MyD88 in cell activation and therapeutic inhibition of TLRs.
21792053 2011 MyD88 and Trif signaling play distinct roles in cardiac dysfunction and mortality during endotoxin shock and polymicrobial sepsis.
21654189 2011 Myeloid differentiation primary response protein 88 blockade upregulates indoleamine 2,3-dioxygenase expression in rheumatoid synovial fibroblasts.
21646294 2011 MyD88-dependent TLR1/2 signals educate dendritic cells with gut-specific imprinting properties.
21640812 2011 Yersinia pestis TIR-domain protein forms dimers that interact with the human adaptor protein MyD88.
21621419 2011 P2X7 receptor positively regulates MyD88-dependent NF-?B activation.
21606507 2011 Polyubiquitin binding to ABIN1 is required to prevent autoimmunity.
21536801 2011 CD300F blocks both MyD88 and TRIF-mediated TLR signaling through activation of Src homology region 2 domain-containing phosphatase 1.
21525878 2011 A single nucleotide polymorphism in the 3'-untranslated region of MyD88 gene is associated with Buerger disease but not with Takayasu arteritis in Japanese.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21383499 2011 A composite MyD88/CD40 switch synergistically activates mouse and human dendritic cells for enhanced antitumor efficacy.
21334391 2011 The hepatitis B e antigen (HBeAg) targets and suppresses activation of the toll-like receptor signaling pathway.
21325272 2011 Natural loss-of-function mutation of myeloid differentiation protein 88 disrupts its ability to form Myddosomes.
21273385 2011 Mycobacterial hypersensitivity pneumonitis requires TLR9-MyD88 in lung CD11b+ CD11c+ cells.
21257927 2011 Fas activation in alveolar epithelial cells induces KC (CXCL1) release by a MyD88-dependent mechanism.
21248248 2011 Absence of MyD88 results in enhanced TLR3-dependent phosphorylation of IRF3 and increased IFN-? and RANTES production.
21179087 2011 Oncogenically active MYD88 mutations in human lymphoma.
21113489 2010 Enhanced expression of iNOS in human endothelial cells during long-term culturing with extracellular DNA fragments.
21057262 2010 Clinical features and outcome of patients with IRAK-4 and MyD88 deficiency.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20966070 2011 Two human MYD88 variants, S34Y and R98C, interfere with MyD88-IRAK4-myddosome assembly.
20957750 2010 TLR3-mediated IFN-? gene induction is negatively regulated by the TLR adaptor MyD88 adaptor-like.
20941850 2010 Dual function of MyD88 in RAS signaling and inflammation, leading to mouse and human cell transformation.
20937539 2011 Hepatitis B virus X protein stimulates IL-6 expression in hepatocytes via a MyD88-dependent pathway.
20880684 2012 Sulphoraphane inhibited the expressions of intercellular adhesion molecule-1 and vascular cell adhesion molecule-1 through MyD88-dependent toll-like receptor-4 pathway in cultured endothelial cells.
20837465 2010 Regulation of MyD88 aggregation and the MyD88-dependent signaling pathway by sequestosome 1 and histone deacetylase 6.
20824098 2010 Myeloid differentiation factor 88 (MyD88)-deficiency increases risk of diabetes in mice.
20817868 2010 IL-27/IFN-? induce MyD88-dependent steroid-resistant airway hyperresponsiveness by inhibiting glucocorticoid signaling in macrophages.
20805788 2010 Human neonatal peripheral blood leukocytes demonstrate pathogen-specific coordinate expression of TLR2, TLR4/MD2, and MyD88 during bacterial infection in vivo.
20802145 2010 Viral inhibitory peptide of TLR4, a peptide derived from vaccinia protein A46, specifically inhibits TLR4 by directly targeting MyD88 adaptor-like and TRIF-related adaptor molecule.
20681284 2010 [Effect of yiqi huoxue recipe containing drug-serum on the Toll-Iike receptor-4 and its downstream signaling components MyD88 as well as the tumor necrosis factor receptor related factor-6 in human vein endothelial cells].
20676093 2010 The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20485341 2010 Helical assembly in the MyD88-IRAK4-IRAK2 complex in TLR/IL-1R signalling.
20463618 2010 Role of polymorphic variants as genetic modulators of infection in neonatal sepsis.
20448286 2010 Association between anti-tumour necrosis factor treatment response and genetic variants within the TLR and NF{kappa}B signalling pathways.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20433840 2010 Pathogenic and protective roles of MyD88 in leukocytes and epithelial cells in mouse models of inflammatory bowel disease.
20410269 2010 Inhibition of hepatitis B virus replication by MyD88 involves accelerated degradation of pregenomic RNA and nuclear retention of pre-S/S RNAs.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20306472 2010 SARM inhibits both TRIF- and MyD88-mediated AP-1 activation.
20219467 2010 Identification of MyD88 as a novel target of miR-155, involved in negative regulation of Helicobacter pylori-induced inflammation.
20197549 2010 MyD88-dependent TLR4 signaling is selectively impaired in alveolar macrophages from asymptomatic HIV+ persons.
20167866 2010 Cooperation of TLR2 with MyD88, PI3K, and Rac1 in lipoteichoic acid-induced cPLA2/COX-2-dependent airway inflammatory responses.
20145615 2010 High expression of Toll-like receptor 4/myeloid differentiation factor 88 signals correlates with poor prognosis in colorectal cancer.
19950169 2010 PKC-alpha controls MYD88-dependent TLR/IL-1R signaling and cytokine production in mouse and human dendritic cells.
19948740 2010 AIP1 functions as Arf6-GAP to negatively regulate TLR4 signaling.
19940113 2010 TILRR, a novel IL-1RI co-receptor, potentiates MyD88 recruitment to control Ras-dependent amplification of NF-kappaB.
19917706 2009 Early response of mucosal epithelial cells during Toxoplasma gondii infection.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19826413 2009 TLR4 signaling induced by lipopolysaccharide or paclitaxel regulates tumor survival and chemoresistance in ovarian cancer.
19786094 2010 IKKalpha negatively regulates IRF-5 function in a MyD88-TRAF6 pathway.
19779605 2009 SOCS2 influences LPS induced human monocyte-derived dendritic cell maturation.
19753301 2009 Inhibitors of MyD88-dependent proinflammatory cytokine production identified utilizing a novel RNA interference screening approach.
19745833 2009 Polymorphisms and haplotypes in TLR9 and MYD88 are associated with the development of Hodgkin's lymphoma: a candidate-gene association study.
19656901 2009 Endotoxin tolerance dysregulates MyD88- and Toll/IL-1R domain-containing adapter inducing IFN-beta-dependent pathways and increases expression of negative regulators of TLR signaling.
19619129 2009 Potentiation of flagellin responses in gut epithelial cells by interferon-gamma is associated with STAT-independent regulation of MyD88 expression.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19592493 2009 An oligomeric signaling platform formed by the Toll-like receptor signal transducers MyD88 and IRAK-4.
19548630 2009 Atorvastatin attenuates TLR4-mediated NF-kappaB activation in a MyD88-dependent pathway.
19543401 2009 Toll-like receptor polymorphisms and susceptibility to urinary tract infections in adult women.
19509286 2009 A TIR domain variant of MyD88 adapter-like (Mal)/TIRAP results in loss of MyD88 binding and reduced TLR2/TLR4 signaling.
19506249 2009 Structural basis for the multiple interactions of the MyD88 TIR domain in TLR4 signaling.
19494325 2009 Lipopolysaccharide stimulates platelet secretion and potentiates platelet aggregation via TLR4/MyD88 and the cGMP-dependent protein kinase pathway.
19488045 2010 Increased excitotoxicity and neuroinflammatory markers in postmortem frontal cortex from bipolar disorder patients.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19297619 2009 Malaria primes the innate immune response due to interferon-gamma induced enhancement of toll-like receptor expression and function.
19281832 2009 Activation of ROS/NF-kappaB and Ca2+/CaM kinase II are necessary for VCAM-1 induction in IL-1beta-treated human tracheal smooth muscle cells.
19265123 2009 Modulation of TLR signaling by multiple MyD88-interacting partners including leucine-rich repeat Fli-I-interacting proteins.
19257978 2009 [Construction of MyD88-Pseudomonas aeruginosa epitope DNA vaccine and its expression in eukaryotic cells].
19254290 2009 Polymorphisms in interleukin-1 receptor-associated kinase 4 are associated with total serum IgE.
19167362 2009 Contribution of globular death domains and unstructured linkers to MyD88.IRAK-4 heterodimer formation: an explanation for the antagonistic activity of MyD88s.
19124728 2009 The EBV-encoded dUTPase activates NF-kappa B through the TLR2 and MyD88-dependent signaling pathway.
19120481 2009 Crosstalk between components of the innate immune system: promoting anti-microbial defenses and avoiding immunopathologies.
19006693 2008 IRAK-4- and MyD88-dependent pathways are essential for the removal of developing autoreactive B cells in humans.
18987746 2008 Association of interacting genes in the toll-like receptor signaling pathway and the antibody response to pertussis vaccination.
18810425 2008 Natural selection in the TLR-related genes in the course of primate evolution.
18802114 2008 Lipoteichoic acid induces HO-1 expression via the TLR2/MyD88/c-Src/NADPH oxidase pathway and Nrf2 in human tracheal smooth muscle cells.
18782768 2008 MKP1 regulates the induction of MUC5AC mucin by Streptococcus pneumoniae pneumolysin by inhibiting the PAK4-JNK signaling pathway.
18776126 2008 Toll-like receptor 9 affects severity of IgA nephropathy.
18771998 2008 Lipopolysaccharide stimulation of trophoblasts induces corticotropin-releasing hormone expression through MyD88.
18768833 2008 MyD88 plays a critical T cell-intrinsic role in supporting CD8 T cell expansion during acute lymphocytic choriomeningitis virus infection.
18719610 2009 Myeloid differentiation factor 88 regulates basal and UV-induced expressions of IL-6 and MMP-1 in human epidermal keratinocytes.
18703508 2008 Aspergillus fumigatus-induced interleukin-8 synthesis by respiratory epithelial cells is controlled by the phosphatidylinositol 3-kinase, p38 MAPK, and ERK1/2 pathways and not by the toll-like receptor-MyD88 pathway.
18669862 2008 Pyogenic bacterial infections in humans with MyD88 deficiency.
18581201 2008 Role of MyD88 in TLR agonist-induced functional alterations of human adipose tissue-derived mesenchymal stem cells.
18571728 2008 Phosphatase PTP1B negatively regulates MyD88- and TRIF-dependent proinflammatory cytokine and type I interferon production in TLR-triggered macrophages.
18541719 2008 Inhibition of TLR3 and TLR4 function and expression in human dendritic cells by helminth parasites.
18539711 2008 Promoter polymorphisms in the IRF3 gene confer protection against systemic lupus erythematosus.
18523439 2008 Upregulated expression of toll-like receptor 4 in monocytes correlates with severity of acute cerebral infarction.
18503546 2008 MyD88-induced downregulation of IRAK-4 and its structural requirements.
18458086 2008 The scaffold MyD88 acts to couple protein kinase Cepsilon to Toll-like receptors.
18325643 2008 Associations between SNPs in toll-like receptors and related intracellular signaling molecules and immune responses to measles vaccine: preliminary results.
18292575 2008 Etk/BMX, a Btk family tyrosine kinase, and Mal contribute to the cross-talk between MyD88 and FAK pathways.
18195069 2008 Eosinophil-derived neurotoxin acts as an alarmin to activate the TLR2-MyD88 signal pathway in dendritic cells and enhances Th2 immune responses.
18086890 2008 Regulation of MyD88-dependent signaling events by S nitrosylation retards toll-like receptor signal transduction and initiation of acute-phase immune responses.
18070982 2008 TRAF6 distinctively mediates MyD88- and IRAK-1-induced activation of NF-kappaB.
17940625 2006 MyD88 predicts chemoresistance to paclitaxel in epithelial ovarian cancer.
17935950 2007 Inhibition of hepatitis B virus replication by MyD88 is mediated by nuclear factor-kappaB activation.
17920759 2007 Constitutive association of MyD88 to IRAK in HTLV-I-transformed T cells.
17905570 2007 MyD88, IRAK1 and TRAF6 knockdown in human chondrocytes inhibits interleukin-1-induced matrix metalloproteinase-13 gene expression and promoter activity by impairing MAP kinase activation.
17583698 2007 Distinct roles of TIR and non-TIR regions in the subcellular localization and signaling properties of MyD88.
17567694 2007 Hepatitis C virus nonstructural protein 5A modulates the toll-like receptor-MyD88-dependent signaling pathway in macrophage cell lines.
17548806 2007 Pivotal Advance: Inhibition of MyD88 dimerization and recruitment of IRAK1 and IRAK4 by a novel peptidomimetic compound.
17513785 2007 The MyD88-independent pathway is not mobilized in human neutrophils stimulated via TLR4.
17507480 2007 MyD88-dependent immune activation mediated by human immunodeficiency virus type 1-encoded Toll-like receptor ligands.
17507369 2007 Mass spectrometric analysis of the endogenous type I interleukin-1 (IL-1) receptor signaling complex formed after IL-1 binding identifies IL-1RAcP, MyD88, and IRAK-4 as the stable components.
17363736 2007 Plasma cells from multiple myeloma patients express B7-H1 (PD-L1) and increase expression after stimulation with IFN-{gamma} and TLR ligands via a MyD88-, TRAF6-, and MEK-dependent pathway.
17258210 2007 MAPPIT analysis of TLR adaptor complexes.
17126326 2006 Extracellular heat shock protein 70 mediates heat stress-induced epidermal growth factor receptor transactivation in A431 carcinoma cells.
16997282 2006 NF-kappaB functions in the nervous system: from development to disease.
16951688 2006 Smad6 negatively regulates interleukin 1-receptor-Toll-like receptor signaling through direct interaction with the adaptor Pellino-1.
16644730 2006 Role of MyD88 in phosphatidylinositol 3-kinase activation by flagellin/toll-like receptor 5 engagement in colonic epithelial cells.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16517750 2006 MyD88 and TNF receptor-associated factor 6 are critical signal transducers in Helicobacter pylori-infected human epithelial cells.
16517734 2006 Modification of MyD88 mRNA splicing and inhibition of IL-1beta signaling in cell culture and in mice with a 2'-O-methoxyethyl-modified oligonucleotide.
16482509 2006 Binding specificity of Toll-like receptor cytoplasmic domains.
16424162 2006 Flightless I homolog negatively modulates the TLR pathway.
16365431 2006 Modulation of TLR4 signaling by a novel adaptor protein signal-transducing adaptor protein-2 in macrophages.
16293622 2006 Localization of TLR2 and MyD88 to Chlamydia trachomatis inclusions. Evidence for signaling by intracellular TLR2 during infection with an obligate intracellular pathogen.
16286016 2005 IL-33, an interleukin-1-like cytokine that signals via the IL-1 receptor-related protein ST2 and induces T helper type 2-associated cytokines.
16236719 2005 Negative regulation of Toll-like-receptor signaling by IRF-4.
16203735 2005 The CATERPILLER protein monarch-1 is an antagonist of toll-like receptor-, tumor necrosis factor alpha-, and Mycobacterium tuberculosis-induced pro-inflammatory signals.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16024789 2005 A novel splice variant of interleukin-1 receptor (IL-1R)-associated kinase 1 plays a negative regulatory role in Toll/IL-1R-induced inflammatory signaling.
15849357 2005 Interactive sites in the MyD88 Toll/interleukin (IL) 1 receptor domain responsible for coupling to the IL1beta signaling pathway.
15845500 2005 Differential induction of the toll-like receptor 4-MyD88-dependent and -independent signaling pathways by endotoxins.
15760459 2005 Mycobacterium bovis bacille Calmette Guerin infection of human neutrophils induces CXCL8 secretion by MyD88-dependent TLR2 and TLR4 activation.
15728506 2005 Human TLR10 is a functional receptor, expressed by B cells and plasmacytoid dendritic cells, which activates gene transcription through MyD88.
15665823 2005 Integral role of IRF-5 in the gene induction programme activated by Toll-like receptors.
15623538 2005 Transforming growth factor-beta differentially inhibits MyD88-dependent, but not TRAM- and TRIF-dependent, lipopolysaccharide-induced TLR4 signaling.
15492225 2004 Role of a transductional-transcriptional processor complex involving MyD88 and IRF-7 in Toll-like receptor signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361868 2004 Interferon-alpha induction through Toll-like receptors involves a direct interaction of IRF7 with MyD88 and TRAF6.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15294994 2004 Toll IL-1 receptors differ in their ability to promote the stabilization of adenosine and uridine-rich elements containing mRNA.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15004556 2004 ST2 is an inhibitor of interleukin 1 receptor and Toll-like receptor 4 signaling and maintains endotoxin tolerance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14630816 2004 Distinct pathways of LPS-induced NF-kappa B activation and cytokine production in human myeloid and nonmyeloid cells defined by selective utilization of MyD88 and Mal/TIRAP.
14625308 2004 Sequential autophosphorylation steps in the interleukin-1 receptor-associated kinase-1 regulate its availability as an adapter in interleukin-1 signaling.
14573621 2004 Helicobacter pylori heat shock protein 60 mediates interleukin-6 production by macrophages via a toll-like receptor (TLR)-2-, TLR-4-, and myeloid differentiation factor 88-independent mechanism.
12885415 2003 MyD88S, a splice variant of MyD88, differentially modulates NF-kappaB- and AP-1-dependent gene expression.
12865424 2003 Reciprocal modulation of Toll-like receptor-4 signaling pathways involving MyD88 and phosphatidylinositol 3-kinase/AKT by saturated and polyunsaturated fatty acids.
12860405 2003 Characterization of Pellino2, a substrate of IRAK1 and IRAK4.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12724322 2003 Bruton's tyrosine kinase is a Toll/interleukin-1 receptor domain-binding protein that participates in nuclear factor kappaB activation by Toll-like receptor 4.
12659850 2003 Characterization of a cascade of protein interactions initiated at the IL-1 receptor.
12646618 2003 Toll-like receptor 3 mediates a more potent antiviral response than Toll-like receptor 4.
12531807 2003 Role of the MyD88 transduction signaling pathway in endothelial activation by antiphospholipid antibodies.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391239 2002 Dysregulation of LPS-induced Toll-like receptor 4-MyD88 complex formation and IL-1 receptor-associated kinase 1 activation in endotoxin-tolerant cells.
11960013 2002 IRAK-4: a novel member of the IRAK family with the properties of an IRAK-kinase.
11909531 2002 Regulation of interleukin-1- and lipopolysaccharide-induced NF-kappaB activation by alternative splicing of MyD88.
11880380 2002 Identification of essential regions in the cytoplasmic tail of interleukin-1 receptor accessory protein critical for interleukin-1 signaling.
11854210 2002 Human gingival CD14(+) fibroblasts primed with gamma interferon increase production of interleukin-8 in response to lipopolysaccharide through up-regulation of membrane CD14 and MyD88 mRNA expression.
11828002 2002 The Fas-associated death domain protein suppresses activation of NF-kappa B by LPS and IL-1 beta.
11743586 2002 Drosophila MyD88 is required for the response to fungal and Gram-positive bacterial infections.
11544529 2001 Mal (MyD88-adapter-like) is required for Toll-like receptor-4 signal transduction.
10952994 2000 Murine TOLL-like receptor 4 confers lipopolysaccharide responsiveness as determined by activation of NF kappa B and expression of the inducible cyclooxygenase.
10880445 2000 The apoptotic signaling pathway activated by Toll-like receptor-2.
10854325 2000 Tollip, a new component of the IL-1RI pathway, links IRAK to the IL-1 receptor.
10383454 1999 IRAK-M is a novel member of the Pelle/interleukin-1 receptor-associated kinase (IRAK) family.
9915784 1999 Association of the p75 neurotrophin receptor with TRAF6.
9716450 1998 Ultrastructural distribution of the death-domain-containing MyD88 protein in HeLa cells.
9575168 1998 MyD88, an adapter protein involved in interleukin-1 signaling.
9374458 1997 IRAK (Pelle) family member IRAK-2 and MyD88 as proximal mediators of IL-1 signaling.
9344657 1997 Genetic structure and chromosomal mapping of MyD88.
9013863 1997 The cloning and characterization of human MyD88: a member of an IL-1 receptor related family.
8957090 1996 Molecular characterization and modular analysis of human MyD88.