Property Summary

NCBI Gene PubMed Count 12
PubMed Score 15.43
PubTator Score 5.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -4.200 4.7e-02
astrocytic glioma -1.200 4.1e-02
ductal carcinoma in situ -1.600 1.4e-04
interstitial cystitis 1.200 1.8e-03
invasive ductal carcinoma -2.300 2.2e-04
lung adenocarcinoma -1.900 2.5e-15
lung cancer -2.700 5.0e-06
lung carcinoma -1.700 1.9e-10
medulloblastoma, large-cell -1.100 1.2e-03
non-small cell lung cancer -2.338 6.1e-31
osteosarcoma -1.863 8.0e-03
psoriasis -1.100 1.2e-08

Synonym

Accession Q8N699 Q8N396 Q8TBE8 Q9H763
Symbols MTLC

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MRTQVYEGLCKNYFSLAVLQRDRIKLLFFDILVFLSVFLLFLLFLVDIMANNTTSLGSPWPENFWEDLIM      1 - 70
SFTVSMAIGLVLGGFIWAVFICLSRRRRASAPISQWSSSRRSRSSYTHGLNRTGFYRHSGCERRSNLSLA     71 - 140
SLTFQRQASLEQANSFPRKSSFRASTFHPFLQCPPLPVETESQLVTLPSSNISPTISTSHSLSRPDYWSS    141 - 210
NSLRVGLSTPPPPAYESIIKAFPDS                                                 211 - 235
//

Text Mined References (16)

PMID Year Title