Property Summary

NCBI Gene PubMed Count 299
PubMed Score 2024.21
PubTator Score 1732.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

 GO Component (2)

 OMIM Phenotype (1)

Gene RIF (259)

PMID Text
27383785 let-7 disruption by LIN28B, MYCN sponging, or genetic loss is a unifying mechanism of neuroblastoma development with broad implications for cancer pathogenesis
27050099 N-Myc and activated AKT1 are sufficient to transform human prostate epithelial cells to prostate adenocarcinoma and neuroendocrine carcinoma. N-Myc is required for tumor maintenance.
26910568 the MNA (MYCN amplification)subclone appears to be constraint by the tumor environment and thus less relevant for tumor behavior in aggressive tumors with a high genomic instability and many segmental aberrations
26858029 the expression of MYCN, HMGA2, and DICER1 seems to be correlated to each other and the expression of the let7-genes impacted by their expression.
26815535 Suppression of MycN in human neural crest stem cells inhibits cell growth and cell cycle progression.
26709890 MYCN gene amplification (MNA) is strongly associated with other clinical and biological variables in neuroblastoma. Recursive partitioning has identified subgroups of neuroblastoma patients with highly disparate rates of MNA.
26683771 study reveals a novel role of MYCN in controlling global splicing program through regulation of splicing factors in addition to its well-known role in the transcription program in nneuroblastomas.
26673823 Oncogenic MYCN re-wires its own interaction and signalling networks to repress regulators of normal cellular developmental processes, such as differentiation.
26650627 Three novel genes were identified as recurrently mutated; MYCN, MYO5B and VCL, and mutations in these genes were exclusively found in malignant sympathetic paraganglioma tumors.
26482175 Authors describe an inverse correlation between WT1 gene expression and MYCN amplification and expression in neuroblastoma tumors.
26471359 Results identify WDR5 as a key cofactor for N-Myc-regulated transcriptional activation and tumorigenesis and as a novel therapeutic target for MYCN-amplified neuroblastomas.
26398570 SOX2, KCNMB4, FOS, GLI3 and GLI1 may be involved in the pathogenesis of neuroblastoma, with the expression of SOX2 downregulating the expression of MYCN.
26306783 Data indicate that suberoylanilide hydroxamic acid (SAHA) blocked the expression of MYCN protein and, by doing so, reduced the effects mediated by this protein.
26290144 The results do not support our hypothesis that common germline genetic variants in the MYCN genes is associated with the risk of developing medulloblastoma.
26202950 This study strongly suggests that AT7519 is a promising drug for the treatment of high-risk neuroblastoma patients with MYCN amplification.
26177922 N-Myc mRNA levels significantly decreased after 24h incubation with nifurtimox in neuroblastoma cell lines.
26171843 Dual-colored fluorescence in situ hybridization on 16 primary neuroblastomas, show that those with unbalanced gain of 17q have high MYCN expression, those with no gain have medium expression, and those with numerical gain have low expression.
26156430 Data suggest that the protein-coding antisense transcript (MYCNOS) functions as a regulator of neuronal MYC (MYCN) ultimately controlling MYCN transcriptional variants.
26123663 LIN28B as an important effector of the MYCN oncogenic phenotype and underline the importance of MYCN-regulated miRNAs in establishing the MYCN-driven oncogenic process.
26068589 The MRN complex is essential to restrain MYCN-induced replication stress during neural cell proliferation.
26053094 Data indicate that the tumor promoting effect of ataxia-telangiectasia mutated (ATM) silencing is MYCN independent.
25973900 ITGA4 expression enhances metastasis in MYCN low neuroblastoma.
25964525 These findings indicate a new way for MYCN-amplified neuroblastoma cells to interact with the tumor environment
25896758 results reveal a novel function of NCYM as a regulator of Myc-nick production in human neuroblastomas
25880909 functional interplay between MYCN, NCYM, and OCT4 contributes to aggressiveness of MYCN-amplified human neuroblastomas.
25864587 results identified a novel mechanism by which IRES-dependent translation of MYCN is repressed by miR-375, particularly during cellular stress
25855136 rs57244888[C] is associated with susceptibility to cutaneous basal cell carcinoma.
25843293 Data identify SKP2 as a direct transcriptional target of MYCN in neuroblastoma cells.
25749049 MYCN gain is prognostically significant in Wilms tumor; the novel P44L somatic variant is likely to be an activating mutation
25736927 ZD55-shMYCN could downregulate phosphoinositide 3-kinase and pAkt and upregulate RKIP levels
25502557 CASP8 SNP D302H (rs1045485) is associated with worse survival in MYCN-amplified neuroblastoma patients
25486413 This article also reviews the surgical approaches to difficult thoracic and abdominal tumors, as well as the role for minimally invasive surgery in the management of localized neuroblastoma.
25477524 analysis of genes interacting functionally with MYCN required to promote fitness of tumor cells facing oncogenic stress
25475555 Author demonstrate that both N-Myc and c-Myc proteins can bind and activate the TWIST1 promoter and propose TWIST1 as a direct MYC transcriptional target.
25475372 These studies implicate PRMT5 in a novel mode of MYCN post-translational regulation.
25277194 N-Myc can promote neuroblastoma cell proliferation through up-regulation of the channel kinases TRPM6 and TRPM7
25266063 Increased beta-catenin expression in human high-risk neuroblastoma tissue without MYCN amplification, is reported.
25231001 There was a significant association between the histological type of samples with MYCN gene amplification.
25175806 Aurora A has conformation-specific effect on proteolytic degradation of MYCN.
25164011 Our findings define Sulf-2 as a novel positive regulator of neuroblastoma pathogenicity that contributes to MYCN oncogenicity.
25142020 ASCT2 expression, which correlates with that of N-Myc and ATF4, is markedly elevated in high-stage neuroblastoma
25104850 p19-INK4d inhibits neuroblastoma cell growth, induces differentiation and is hypermethylated and downregulated in MYCN-amplified neuroblastomas.
25100564 Trim32 is a positive regulator of ACD that acts against MYCN and should be considered as a tumor-suppressor candidate
24906397 The data demonstrates the important roles of lncUSMycN and NonO in regulating N-Myc expression.
24719420 N-Myc inhibits foamy virus by sequestering viral Tas protein in the cytoplasm.
24608896 SUMOylation may be part of a quality-control mechanism acting on misfolded Myc proteins.
24603724 Data indicate that the fastest tumor progression was observed with the undifferentiated MYCN amplified SK-N-BE neuroblastoma cells in inoculated mice.
24586304 N-Myc-mediated suppression of linc00467 gene transcription counterintuitively blocks N-Myc-mediated reduction in RD3 mRNA expression, and reduces neuroblastoma cell survival by inducing DKK1 expression
24556696 Suggest that MYCN is necessary during the activation of neuroblastoma differentiation to induce apoptosis in cells that are not committed to differentiate.
24515800 Here we describe an alternative approach to address deregulated MYCN expression. In particular, we focus on the role of a 3' untranslated region (3'UTR) of the MYCN gene in the modulation of its mRNA fate and identification of compounds able to affect it.
24481781 Our findings suggest that Myc-mediated transcriptional repression of JARID1B counterintuitively inhibits Myc-regulated cell proliferation and potentially tumorigenesis.
24481548 An increase in histone H4 acetylation caused by hypoxia in human neuroblastoma cell lines corresponds to increased levels of N-myc transcription factor in these cells.
24470553 Patients with supratentorial primitive neuroectodermal tumors harboring MYCN amplification showed unfavorable overall survival
24419085 A significant role for HDAC3 in the MYCN-mediated repression of GRHL1.
24403858 MXI1-0 appears to be a downstream target of MYCN-dependent signaling pathways and may contribute to N-Myc-dependent cell growth and proliferation.
24391509 these results suggest that GSK3b inhibition by NCYM stabilizes the MYCN protein both in vitro and in vivo.
24356251 ALK is a MYCN target gene and regulates cell migration and invasion in neuroblastoma
24334727 Results showed that MYCN is frequently overexpressed in pediatric T-ALL.
24282277 Data indicate glycogen synthase kinase 3-mediated regulation of MYCN mRNA levels through p53 tumor suppressor protein.
24260886 Event-free survival and overall survival in MYCN-amplified patients as well as in patients with 1p deletion were significantly lower comparing with MYCN-negative patients or patients without 1p deletion.
24190252 destabilization of MYC/MYCN by MIBG, metformin and phenformin and their effects on histone modification are important mechanisms underlying their anticancer effects
24173829 we investigated the effect of S(+)-ibuprofen on neuroblastoma cell lines, focusing on the expression of the MYCN, MYC, AKT, p53 proteins and the favorable neuroblastoma genes in vitro as biomarkers of malignancy
24130166 MYCN and survivin cooperatively contribute to malignant transformation of fibroblasts.
24011394 Downregulation of MYCN by small interfering RNA (siRNA) increased DPYSL3 levels, while upregulation of MYCN in non-MYCN NB cells decreased DPYSL3 levels.
23991020 Data indicate that the signal of EIF5A2, MYCN, and MCL1 genes is decreased in hydroxyurea (HU) and gemcitabine (GEM) treated UACC-1598 ovarian cancer cell line.
23962557 Data show that downregulation of aurora A kinase by the therapeutic antibody is associated with decreased levels of MYCN protein in cytoplasm, and induced expression of PHLDA1 and P53 proteins.
23901000 High MYCN protein expression is associated with neuroblastoma of undifferentiated subtype.
23851507 findings provide a tumor-suppressing mechanism by which RUNX3 inhibits the MYCN activity in neuroblastoma
23812427 findings show N-Myc upregulated HDAC5 expression in neuroblastoma cells; HDAC5 repressed NEDD4 gene expression,increased Aurora A gene expression and consequently upregulated N-Myc protein expression;data identify HDAC5 as a novel co-factor in N-Myc oncogenesis
23639551 MYCN/LIN28B/Let-7/HMGA2 pathway implicated by meta-analysis of GWAS in suppression of post-natal proliferation thereby potentially contributing to aging
23578955 analysis confirms that aCGH is as safe as FISH for the detection of MYC/MYCN gene amplification
23563570 A functional change in MYCN mRNA levels and increased MYCN expression in cisplatin-resistant neuroblastoma cells do not have a clear relationship to MYCN copy numbers.
23539269 Histone H3.3. mutations drive pediatric glioblastoma through upregulation of MYCN.
23498719 Amplification of the MYCN oncogene might initiate retinoblastoma in the presence of non-mutated RB1 genes. These unilateral RB1(+/+)MYCN(A) retinoblastomas are characterised by distinct histological features.
23430699 Integration of genetic features with chemosensitivity data revealed a robust correlation between MYCN amplification and sensitivity to bromodomain inhibition.
23362253 Binding of MYCN to the CLU gene induces bivalent epigenetic marks and recruitment of repressive proteins such as histone deacetylases and Polycomb members.
23358695 There was 100% concordance of ERG rearrangement, 100% concordance of AURKA amplification, and 60% concordance of MYCN amplification.
23341988 influence of MYCN amplification and 11q deletion in neuroblastoma
23320395 Suggest MYCN plays an important role in neuroblastic tumor differentiation and MYCN gain may define subgroup of tumors with better outcome.
23317189 Amplifications of MYCN gene is associated with neuroblastoma.
23308108 The homozygously deleted RGS5 gene is a newly identified indirect MYCN down regulated gene.
23284678 TH-MYCN tumors have few genetic aberrations
23280764 MYCN is recruited to the RASSF1A promoter but is not critical for DNA hypermethylation in neuroblastoma.
23186832 MYCN-mediated overexpression of mitotic spindle regulatory genes and loss of p53-p21 function jointly support the survival of tetraploid neuroblastoma cells.
23152863 Galectin-3 impairs MYCN-primed and HIPK2-p53-dependent apoptosis in neuroblastoma cells.
23091029 Downstream targets of MYCN by siRNA-mediated silencing MYCN in neuroblastoma cells, were identified.
23042116 LIN28B signaled through repression of the let-7 miRNAs and consequently resulted in elevated MYCN protein expression in neuroblastoma cells
22975311 a novel Atx transcriptional mechanism involving AP-1 and SP transcription factors
22921766 a functional axis between MYCN and CDKL5 governing both neuron proliferation rate and differentiation.
22907436 a general mechanism for p53 inactivation in some embryonal cell types and consequent susceptibility to MycN oncogenesis at the point of embryonal tumor initiation
22907398 Pathway analyses suggested transcriptomal upregulation of mTOR-related genes by MYCN.
22751132 Epigenetic regulation of the neuroblastoma genes, Arid3b and Mycn.
22624711 Demonstrate context-dependent transformation of neural stem cells in response to common oncogenic signal N-MYC.
22484425 Tumorigenicity was enhanced upon serial transplantation of tumor-derived cells, and tumor cells remained susceptible to the MYC-inhibitor, NBT-272, indicating that cell growth depended on functional MYCN.
22439933 Coexpression of activated ALK with MYCN provides prosurvival signals that block this apoptotic response and allow continued expansion and oncogenic transformation of hyperplastic neuroblasts, thus promoting progression to neuroblastoma.
22383024 Post-surgical chemotherapy was therefore unnecessary for localized patients without MYCN amplification . This treatment strategy using MYCN amplification is considered to be appropriate in infants
22337647 Elevated expression of 14 key genes promoting this function is strongly associated to high-risk neuroblastomas with 1p loss and MYCN amplification in a set of 410 tumor samples.
22286764 Both wild-type and gain-of-function mutants in ALK are able to stimulate transcription at the MYCN promoter.
22218692 Paracrine signaling through MYCN enhances tumor-vascular interactions in neuroblastoma
22202125 findings show that GSTP1 expression is an independent prognostic indicator of clinical outcome in primary neuroblastoma and is a direct transcriptional target of the N-Myc oncoprotein
22146831 In infants with stage 4s MYCN-non-amplified NB, a SCA genomic profile identifies patients who will require upfront treatment even in the absence of other clinical indication for therapy
22123490 Coamplification of multiple segments of chromosome 2, including an MYCN-bearing segment, was examined in 2 cancer cell lines, NCI-H69 (lung cancer) and IMR-32 (neuroblastoma).
22120721 MYCN, an oncoprotein in the pathogenesis of high-risk neuroblastomas, is able to counteract the death-inducing effect of BMI1 knockdown by activating CCNE1 transcription
22090452 A more tailored subgrouping system based on expression profiles of chromosome 17p, MYCC, and MYCN, which may provide the basis for a novel risk-stratification strategy in pediatric medulloblastoma.
22068108 Gas41 is able to bind both n-Myc and c-Myc proteins, and that the levels of expression of Gas41 and Myc proteins were similar to each other in such brain tumors as neuroblastomas and glioblastomas.
22065083 N-Myc, with its restricted expression in non-fetal tissues, is a therapeutic target to treat rhabdomyosarcomas
22052359 The downstream response to DNA damage in p53 wild-type neuroblastoma cell lines is p53 dependent, and determined both by the morphological sub-type and MYCN expression.
22035742 A high frequency of MYCN co-amplication with ACP1 was observed (14 of 40 cases, 35%).
21929510 Over 22% of cases have N-myc amplification associated with aggressively growing neuroblastomas.
21908575 NLRR3 is a direct target of MYCN, which associates with Miz-1 and negatively regulates NLRR3 expression. NLRR3 may play a role in NBL differentiation and the survival of NBL patients by inversely correlating with MYCN amplification.
21882282 Focal gain of MYCN, initially detected by high resolution aCGH profiling in 6/61 anaplastic samples.
21862876 Interaction between MDM2 and MYCN synthetically regulates p53 in neuroblastoma cells.
21856782 dysregulation of the BMI1 gene mediated by MYCN or MYC overexpression, confers increased cell proliferation during neuroblastoma genesis and tumor progression
21822304 Here, we report that MYCN expression was regulated by the oncoprotein MDM2 at the post-transcriptional level and was associated with neuroblastoma cell growth.
21796619 majority of all detected 1q deletions was found in high risk 11q deleted tumors without MYCN amplification
21796614 study demonstrates that the MYCN-induced downregulation of Dickkopf-3 (DKK3) results from direct upregulation of miR-17-92 components effecting both DKK3 mRNA stability
21750863 The MYCN amplicon junction is a patient/tumor-specific target that can be used for minimal residual disease detection in neuroblastoma.
21731748 MYCN and MeCP2 protein interact and co-localize to similar genomic sites at very high frequency.
21725357 Data indicate that MYCN is a central modulator of the p53/MDM2/p14ARF negative feedback loop.
21646478 Sna1 directly induced transcription of N-Myc in human medulloblastoma cells. Depletion of N-Myc ablated the Sna1-induced proliferation and transformation.
21572098 data demonstrate that MYCN-regulated miRNAs are able to modulate the expression of the tumor suppressor DKK3 in neuroblastoma
21533284 results associate deregulation of MYCN and downstream targets, including Let-7 and oncofetal genes, with serous ovarian cancer
21508638 Complex structural rearrangements involving genomic losses and gains in the 2p24 region lead to MYCN amplification and that these rearrangements can trigger amplification events.
21501490 results demonstrated a significant role of alternative splicing in high stage neuroblastoma, and suggested a MYCN-associated splicing regulation pathway in stage 4+ tumors
21498633 MYCN is a major driver of neuroblastoma tumorigenesis and MYCN amplification is the worst prognostic indicator of aggressive NB.
21384249 In a microgravity assay of neuroblastoma cells, a MYCN-amplified cell line aggregated much more rapidly and the organoid morphology was noticeably different compared to unamplified lines.
21378543 The high incidence of TP53 mutations and absence of amplification of c-myc and N-myc genes indicates that supratentorial neuroectodermal tumors are a specific subset of these CNS tumors.
21370425 High MYCN copy number is associated with central nervous system relapse in neuroblastoma.
21304178 study concludes that MYCN and B-MYB are engaged in a reciprocal regulatory loop whose pharmacological targeting could be beneficial to patients with the aggressive forms of cancer in which MYCN is amplified
21297076 MYCN is associated with acute lung injury in mice
21288077 MYCN amplification did not automatically equate to a poor prognosis in this group of patients with neuroblastoma
21258086 initiation of MYCN amplification may be caused by extra replication rounds of secondary DNA structures accumulated at FRA2Ctel and/ or FRA2Ccen
21224895 tudy identified an MYCN mutation in 50% of our cases (8/17);No major phenotypic differences could be found among the core features of Feingold syndrome retrospectively, between patients with and without a MYCN mutation
21214410 MYCN amplification is associated with tumor necrosis following chemotherapy in neuroblastoma.
21173028 Data show that p53(S46) kinase HIPK2 accumulates on MYCN expression, and its depletion by RNA interference impairs p53(S46) phosphorylation and apoptosis.
21123453 By directly connecting MYCN to the repression of TRKA and p75NTR, findings establish a key pathway of clinical pathogenicity and aggressiveness in neuroblastoma.
21112821 results demonstrate for the first time that N-Myc is a downstream target of RET2A signaling, and propose that induction of N-Myc by RET2A is a key step leading to lower p18 levels during MEN2A tumorigenesis
21073496 found a point mutation affecting codon 34 (GGA --> GTA) of beta-Catenin gene resulting in a Glycine --> Valine substitution. No cases presented c-myc/N-myc amplification
21046119 In pediatric neuroblastoma, MYCN gain detected by FISH represents the 2p gain, and the MYCN gain is not considered to represent the pre-status of MYCN amplification.
20980091 subset of miRNAs altered during MYCN knockdown-mediated differentiation of neuroblastoma cells; Mir-21 was up-regulated, but inhibition of mir-21 did not prevent differentiation; unable to establish role for this miRNA during differentiation of the cells
20961996 Results provide mechanistic insights explaining how MYCN-amplified neuroblastoma cells contend with hypoxic stress and paradoxically how hypoxia contributes to neuroblastoma aggressiveness through combinatorial effects of N-Myc and HIF-1alpha.
20811720 Down regulation or hyper-expression of MYCN results in growth inhibition and/or apoptosis of MYCN-amplified neuroblastoma cells. Elevated p53 expression has a suppressive effect on MYCN expression in these cells.
20719933 Studies indicate that ALK mutations occur in equal frequencies across all genomic subtypes, but F1174L mutants are observed in a higher frequency of MYCN-amplified tumors and show increased transforming capacity as compared with the R1275Q mutants.
20607354 MYCN copy number increases are associated with medulloblastoma.
20575024 characterize the prevalence of REL, BCL11A, and MYCN gains in a consecutive CLL series at the time of diagnosis; (ii) define the prognostic relevance of REL, BCL11A, and MYCN gains in CLL.
20478998 Targeted expression of MYCN thus contributes to initiation, progression, and maintenance of MB, suggesting a central role for MYCN in pathogenesis
20425471 Feingold syndrome is caused by germline mutations in, or deletions of, the MYCN gene on chromosome 2p24.1. It is the most frequent cause of familial syndromic gastrointestinal atresias.plic
20424123 SKP2 activation through the transcriptional start site in MYCN-amplified cells is associated with the low abundance of pRB-E2F1 complexes bound to the SKP2 promoter in neuroblastoma.
20409325 MYCN contributes to tumorigenesis, in part, by repressing miR-184, leading to increased levels of AKT2, a direct target of miR-184
20395439 Results suggest that the determination of MYCN gene copy number relative to chromosome 2 may help to reveal the underlying genetic pattern of neuroblastomas and their clinical behavior.
20332316 Because MYCN is itself a target of FBXW7-mediated ubiquitination and degradation, it is suggested that a common pathway is dysregulated by different mechanisms in various Wilms'tumor subtypes.
20332316 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20236072 REVIEW: NO-MYCN-ABC transporters axis with important implication on development and control of the chemoresistance phenotype in neuronal tumours
20190806 Bmi1 is a MYCN target gene that regulates tumorigenesis through repression of KIF1Bbeta and TSLC1 in neuroblastoma.
20180881 Regulation of GCL(cat) by MYCN accounts for the survival of neuroblastoma cells against oxidative damage; GCL should be considered a potential therapeutic target for the treatment of MYCN-amplified neuroblastoma.
20179233 VEGFR-1 and sVEGFR-2, and upregulation of angiogenic activators VEGF-A and VEGF-D in MYCN-amplified stage IV neuroblastoma supports the crucial effect of this oncogene on neuroblastoma progression
20173740 miR-9 miRNA downregulates E-cadherin. Expression of miR-9 is activated by MYC and MYCN, which bind to the mir-9-3 locus. Elevated expression of miR-9 may contribute to epithelial-mesenchymal transition and metastasis in some and possibly many tumours.
20145147 MYCN transcriptionally upregulates p53 in neuroblastoma and uses p53 to mediate a key mechanism of apoptosis.
20144241 Increasing extracellular matrix stiffness also reduces expression of N-Myc, a transcription factor involved in multiple aspects of oncogenic proliferation.
20103633 Data show the downregulation of MHC class I, ERAP1, and ERAP2 in aggressive NB cells is attributable to a low transcriptional availability of NF-kappaB, possibly due to an unknown suppressor other than MYCN.
20080637 MYCN amplification may disrupt estrogen signaling sensitivity in primitive sympathetic cells through deregulation of estrogen receptor-alpha.
20017904 Existence of upstream ORF in MYCN transcripts leads to a new level of MYCN regulation.
20007697 Data show that TG2-L and TG2-S enhanced neuroblastoma cell differentiation due to N-Myc small interfering RNA, and suppression of vasoactive intestinal peptide (VIP) expression alone induced neuroblastoma cell differentiation.
19997598 The co-localization of MYCN binding and DNA hypermethylation further supports the dual role of MYCN, namely that of a classical transcription factor affecting the activity of individual genes, and that of a mediator of global chromatin structure.
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19946337 MYCN/c-MYC-induced microRNAs repress coding gene networks associated with poor outcome in MYCN/c-MYC-activated tumors.
19924232 analysis of MiRNA dysregulation by MYCN amplification and chromosomal imbalances in neuroblastoma
19885598 induction of MycN in non-MYCN-amplified cells drives neuroblastoma cells toward apoptosis; combination nutlin-3/doxorubicin treatment may be clinically important
19852433 Clinical presentation of the family was suggestive of Feingold syndrome, and genetic testing of the MYCN gene confirmed the diagnosis. The missense mutation we report here has not been described previously.
19766596 present results suggest that MYCN contributes to its own expression by forming a positive auto-regulatory loop in neuroblastoma cells.
19724862 MycN is required for livin expression and that livin may counteract the proapoptotic effects of MycNin neuroblastoma cells.
19656550 Synchronic MYCN and ALK aberrations accounted for 51% of the neuroblastomas studied.
19649205 We hypothesize that MDM2 contributes to MYCN-driven tumorigenesis in neuroblastoma
19615087 The MYCNOS:MYCN-ratio in neuroblastoma is significantly correlated with both MYCN-amplification and NB-stage. Data indicate that in NB, MYCN expression levels might be influenced by MYCNOS but not by DeltaMYCN.
19608868 These findings establish the identity of neuroblasts that characterize the tumor phenotype and suggest a cellular pathway by which MYCN can promote neuroblastoma development.
19495417 N-Myc regulates expression of pluripotency genes in neuroblastoma including lif, klf2, klf4, and lin28b
19401549 MYCN induces microRNAs that suppress clusterin expression.
19301388 serum-based MYCN DNA sequence determination depends on the stage of the disease.
19208763 Results describe for the very first time a direct regulation of an oncogene, MYCN, by a proneural gene, Mash1.
19111882 Aurora A interacts with both N-Myc and the SCF(Fbxw7) ubiquitin ligase that ubiquitinates N-Myc and counteracts degradation of N-Myc, thereby uncoupling N-Myc stability from growth factor-dependent signals
19061778 findings show MYCN amplification was not correlated with centrosome amplification in sporadic neuroblastomas
19047152 Transcriptome analyses show that MYCN-amplified neuroblastomas have coordinately deregulated myriad polyamine enzymes (including ODC1, SRM, SMS, AMD1, OAZ2, and SMOX) to enhance polyamine biosynthesis.
19047142 Findings support a new dual model for Myc chromatin function with important implications for the role of Myc in cancer and stem cell biology, including that of induced pluripotent stem cells.
19006223 In neuroblastic tumors, MYCN amplification was detected in 35.3% of the cases, whereas 1p36 deletion and 17q23 gain was observed in 46.8% and 58.3% of the cases
18955045 MycN and DNA methylation are responsible for CRABP-II expression in pediatric tumors and demethylation of CRABP-II may be an early event in tumor development.
18949372 Vasoactive intestinal peptide decreases MYCN expression and synergizes with retinoic acid in a human MYCN-amplified neuroblastoma cell line.
18851746 Distinct transcriptional MYCN/c-MYC activities are associated with spontaneous regression or malignant progression in neuroblastomas
18785023 MYCN gain is associated with the late stage of retinoblastoma.
18769732 Binomial segregation at cell division explains the high degree of MYCN copy-number variability in neuroblastoma.
18671284 Two novel MYCN mutations in sporadic and familial cases of Feingold syndrome are described.
18610847 Transcription levels of the MYCN gene in blood cell subpopulations of Patients with leukemia
18591937 N-MYC promotes cell proliferation through a direct transactivation of neuronal leucine-rich repeat protein-1 (NLRR1) gene in neuroblastoma.
18504438 identified that three out of the five microRNAs target MYCN and of these miR-34a caused the most significant suppression of cell growth through increased apoptosis and decreased DNA synthesis in neuroblastoma cell lines with MYCN amplification
18488021 Huwe1 links destruction of N-Myc to the quiescent state that complements differentiation in the neural tissue
18470948 report 11 novel mutations in MYCN-related Feingold syndrome, including seven mutations in exon 2 that result in a premature termination codon in the long MYCN transcript, and review the clinical features of these patients
18391076 cyclin E expression in 2 t(11;14)-negative mantle cell lymphomas characterized by a cryptic t(2;14)(p24;q32) and identification of MYCN as a new lymphoma oncogene associated with a blastoid mantle cell lymphoma
18348317 MYCN genomic copy number from 44 human brain tumors (22 medulloblastomas and 22 neurocytomas) was determined.
18335505 The PAX3-FKHR protein acts directly on the MYCN gene at the transcriptional level. PAX3-FKHR contributes to the expression of MYCN and in turn MYCN collaborates with PAX3-FKHR in tumorigenesis.
18281664 Tumor cell ploidy may be a clinically useful factor for prognostication and treatment stratification in children with MYCN-amplified, favorable-stage NB tumors.
18278068 N-myc is a novel regulator of PI3K-mediated VEGF expression in neuroblastoma
18198336 These data represent the first example of a role for a Myc family member in retinal development and the first characterization of a mouse model in which the hypocellular retina is properly proportioned to the other ocular structures
18165268 besides MYCN and ALK, other genes proximal and distal to MYCN are highly expressed in neuroblastoma
18097563 keratoepithelin induces elevated TFPI2 transcript levels in neuroblastoma cells without alterations of MYCN expression.
18059033 Analysis of 2 neuroblastoma cell lines with inducible activity of MYCN showed that DKK3 is down-regulated by MYCN. MYCN expression is inversely correlated with expression of DKK3.
18004567 strong and specific immune responses against MYCN expressing tumours are possible in patients with the most common HLA class 1 type in the Caucasian population.
17710228 MYCN-mediated immune escape mechanism, which we believe to be novel, is operative in metastatic cancer and should be considered in tumor immunobiology
17704800 A truncated form of N-Myc wild type can fully rescue the proliferation defect in myc-null fibroblasts, but rescue is dependent on the highly conserved Myc homology box II.
17643814 MYCN might stimulate cell proliferation by inhibiting the expression of DKK1. DKK1 might exert part of its growth suppressive effect by induction of SYNPO2 expression.
17611020 Concomitant DDX1 and MYCN gain is associated with neuroblastoma
17554788 MYCN retinoic acid response is not mediated solely though the region controlling basal activity.
17535087 MYCN was amplified in one clone of neuroblastoma with an unfavorable histology.
17525631 An association was found between MYCN amplifcation and 1p deletion in neuroblastomas with high tumor vascularity.
17506115 MYCN-amplified and non-amplified cell lines form separate classes according to their metabolite profiles.
17495526 MYCN may override the G1 checkpoint through down-regulation of SKP2 and TP53INP1 resulting in reduced p21(WAF1) expression in p53 wt cell lines, and in addition may act through the WNT signaling pathway in a p53 independent manner.
17464317 High levels of MYCN expression was useful for distinguishing synovial sarcoma from other childhood-spindled cell sarcomas.
17327229 N-MYC induces FAK expression.
17289033 the N-terminal region of the p14(ARF) protein is involved in binding to c-Myc and N-Myc proteins
17213019 Chromosome 1p36 deletion and MYCN amplification status may be reliable parameters in determining unfavorable histology and predicting prognosis in neuroblastoma.
17172827 Lower levels of p21WAF1 and hypo retionblastoma protein induction and a failure to G1 arrest in MYCN amplified neuroblastoma cell lines after DNA damage.
17055458 These data show that small interfering RNA directed to MYCN, which plays a crucial role in neuroblastoma cell survival, may provide a potential novel therapeutic option for aggressive neuroblastomas.
17023822 The expression of MYCN in tumor cells, and the sensitivity of detection of MYCN by RT-PCR noted in this and other studies, supports further evaluation of MYCN as a NB marker for molecular detection of minimal residual disease.
17020972 MYCN amplification in any form (HSRs or dmins) is associated with a poor outcome.
16912192 Rationale to test PI3K inhibitors in MYCN-amplified neuroblastoma represent a therapeutic approach applicable to a broad range of cancers in which transcription factors are stabilize.
16912187 MycN binds to the promoter of CRABP-II and induces CRABP-II transcription directly in neuroblastoma.
16596176 Recurrent NMYC copy number gain and high protein expression is associated with basal cell carcinoma
16516635 combination of gene dosages of MYCN and Survivin and the expression level of BIN1 using the quantitative polymerase chain reaction method was significantly correlated with the clinical stage and the patients' outcome in neuroblastoma
16278682 propose that haploinsufficiency of HuD due to chromosome #1p deletion in neuroblastoma selects for cells that amplify N-myc genes
16166307 HMGA1 repression by RNA interference reduced neuroblastoma cell proliferation, indicating that HMGA1 is a novel MYCN target gene relevant for neuroblastoma tumorigenesis.
15833843 N-myc down-regulates the mRNA expression of many genes with a role in cell architecture.
15660126 N-myc is recruited to the EAAT2 promoter with TNFalpha
15644444 finding that MYCN directly modulates baseline MDM2 levels suggests a mechanism contributing to the pathogenesis of neuroblastoma and other MYC-driven malignancies through inhibition of MYC-stimulated apoptosis
15632181 mechanistic link between N-Myc and death receptor machinery, which may serve as a checkpoint to guard the cell from N-Myc-initiated tumorigenesis.
15547663 characterized MYCN amplification and chromosome 2 aneusomy in 12 patients with neuroblastoma
15331636 Data show that nitric oxide negatively regulates proliferation and promotes neuronal differentiation through N-Myc downregulation.
15316056 Clustering of neuroblastoma cell lines on the basis of hypermethylation distinguished lines with MYCN amplification (a negative prognostic factor) from those without it (P =.012).
15314226 These data suggest that inappropriate perinatal MycN expression in paravertebral ganglia cells from transgenic MYCN mice initiated tumorigenesis by altering the physiologic process of neural crest cell deletion.
15258910 decreased MYCN expression and MYCN DNA-binding is correlated with retarded cell cycle progression
15218241 Low level gain for a segment of 2p was detected in five of the 15 neuroblastomas that had high level MYCN amplification. The possibility that low level gain of distal 2p is a risk factor for high level MYCN amplification is discussed.
15198123 While survival rates were higher for patients with low N-myc expression, these differences were not statistically significant.
15117961 N-myc-associated tumor aggressiveness is mediated by nestin
14737110 MYCN induction in human NB cells results in increased MRP1 mRNA and protein levels
14719101 NMYC is inhibited by peptide nucleic acid in N-myc amplified human neuroblastoma cells
14647433 overexpression of MYCN abrogates the regulation of the centrosome cycle after DNA damage
14645238 MYCN is not activated in neuroblastoma by E2F and Sp1/Sp3
12907629 The identification of coexpressed and coamplified genes associated with MYCN overexpression in neuroblastoma suggests biochemical pathways that contribute to the malignant behavior of these tumors and forms a basis for molecular classification.
12819037 Data show that the MycN protein activates MDR1 transcription both in exogenous transient MYCN-transfected cells and in endogenous metastatic neuroblasts.
12808116 expressed in human neuroblastoma cells in response to retinoic acid
12670915 Transcriptional regulation of ID2 by the MycN oncoprotein is unlikely to be a seminal molecular event resulting in a highly malignant neuroblastoma phenotype.
12660036 Amplification of MYCN and deletion of TP53 with complex cytogenetic abnormalities in a case of pleuropulmonary blastoma
12545167 We found no correlation between MYCN and ID2 expression in neuroblastoma cell lines or tumor specimens. However, we did find a significant positive correlation between MYC and ID2 expressions in both MYCN-amplified and single-copy tumor specimens
12438307 data suggest that E2F transcription factors are critical for both the full activation and the repression of MYCN in neuroblastomas
12232763 High level amplification of N-MYC is not associated with adverse histology or outcome in primary retinoblastoma tumours.
12219017 Importance of Sp1 consensus motifs in the MYCN promoter.
12192602 N-myc gene modulates expression of p73, allowing neuroblastoma cells to escape the growth suppressing properties of p73
12153570 experimental N-Myc overexpression results in down-regulation of leukemia inhibitory factor (LIF), a modulator of endothelial cell proliferation
11881792 nmyc gene amplification heavily influences survival in neuroblastoma in children.
11861392 Minichromosome maintenance protein MCM7 is a direct target of the MYCN transcription factor in neuroblastoma.
11850545 MYCN gene copy number is determined with a real-time quantitative PCR (Q-PCR) assay and fluorescence in situ hybridization (FISH) analysis.
11826111 N-myc promotes survival and induces S-phase entry of postmitotic sympathetic neurons

AA Sequence

MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEH      1 - 70
SSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGP     71 - 140
PTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPA    141 - 210
SAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVV    211 - 280
TVEKRRSSSNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKI    281 - 350
KSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV    351 - 420
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC                              421 - 464
//

Text Mined References (301)

PMID Year Title
27383785 2016 Multiple mechanisms disrupt the let-7 microRNA family in neuroblastoma.
27050099 2016 N-Myc Drives Neuroendocrine Prostate Cancer Initiated from Human Prostate Epithelial Cells.
26910568 2016 The genetic tumor background is an important determinant for heterogeneous MYCN-amplified neuroblastoma.
26858029 2016 The MYCN-HMGA2-CDKN2A pathway in non-small cell lung carcinoma--differences in histological subtypes.
26815535 2016 MycN Is Critical for the Maintenance of Human Embryonic Stem Cell-Derived Neural Crest Stem Cells.
26766587 2016 The Interaction of Myc with Miz1 Defines Medulloblastoma Subgroup Identity.
26709890 2016 Identification of patient subgroups with markedly disparate rates of MYCN amplification in neuroblastoma: A report from the International Neuroblastoma Risk Group project.
26683771 2016 MYCN controls an alternative RNA splicing program in high-risk metastatic neuroblastoma.
26673823 2015 Integrative omics reveals MYCN as a global suppressor of cellular signalling and enables network-based therapeutic target discovery in neuroblastoma.
26650627 2016 Malignant pheochromocytomas/paragangliomas harbor mutations in transport and cell adhesion genes.
26482175 2016 WT1 expression is inversely correlated with MYCN amplification or expression and associated with poor survival in non-MYCN-amplified neuroblastoma.
26471359 2015 WDR5 Supports an N-Myc Transcriptional Complex That Drives a Protumorigenic Gene Expression Signature in Neuroblastoma.
26398570 2015 Microarray data analysis of neuroblastoma: Expression of SOX2 downregulates the expression of MYCN.
26306783 2015 MYCN concurrence with SAHA-induced cell death in human neuroblastoma cells.
26290144 2015 CCND2, CTNNB1, DDX3X, GLI2, SMARCA4, MYC, MYCN, PTCH1, TP53, and MLL2 gene variants and risk of childhood medulloblastoma.
26202950 2015 Cyclin-Dependent Kinase Inhibitor AT7519 as a Potential Drug for MYCN-Dependent Neuroblastoma.
26177922 2015 Nifurtimox reduces N-Myc expression and aerobic glycolysis in neuroblastoma.
26171843 2015 MYCN overexpression is associated with unbalanced copy number gain, altered nuclear location, and overexpression of chromosome arm 17q genes in neuroblastoma tumors and cell lines.
26156430 2015 MYCNOS functions as an antisense RNA regulating MYCN.
26123663 2015 MYCN-driven regulatory mechanisms controlling LIN28B in neuroblastoma.
26068589 2016 The MRN complex is transcriptionally regulated by MYCN during neural cell proliferation to control replication stress.
26053094 2015 Ataxia-telangiectasia mutated (ATM) silencing promotes neuroblastoma progression through a MYCN independent mechanism.
25973900 2015 Integrin ?4 Enhances Metastasis and May Be Associated with Poor Prognosis in MYCN-low Neuroblastoma.
25964525 2015 Exosome-like Extracellular Vesicles from MYCN-amplified Neuroblastoma Cells Contain Oncogenic miRNAs.
25896758 2015 NCYM promotes calpain-mediated Myc-nick production in human MYCN-amplified neuroblastoma cells.
25880909 2015 Functional interplay between MYCN, NCYM, and OCT4 promotes aggressiveness of human neuroblastomas.
25864587 2015 Targeting MYCN IRES in MYCN-amplified neuroblastoma with miR-375 inhibits tumor growth and sensitizes tumor cells to radiation.
25855136 2015 New basal cell carcinoma susceptibility loci.
25843293 2015 SKP2 is a direct transcriptional target of MYCN and a potential therapeutic target in neuroblastoma.
25749049 2015 Multiple mechanisms of MYCN dysregulation in Wilms tumour.
25736927 2015 Oncolytic adenovirus-mediated short hairpin RNA targeting MYCN gene induces apoptosis by upregulating RKIP in neuroblastoma.
25533335 2015 Combined MYC and P53 defects emerge at medulloblastoma relapse and define rapidly progressive, therapeutically targetable disease.
25502557 2014 CASP8 SNP D302H (rs1045485) is associated with worse survival in MYCN-amplified neuroblastoma patients.
25486413 2014 Advances in the surgical treatment of neuroblastoma: a review.
25477524 2015 Identification and pharmacological inactivation of the MYCN gene network as a therapeutic strategy for neuroblastic tumor cells.
25475555 2015 TWIST1 is a direct transcriptional target of MYCN and MYC in neuroblastoma.
25475372 2015 Protein arginine methyltransferase 5 is a key regulator of the MYCN oncoprotein in neuroblastoma cells.
25277194 2014 N-Myc-induced up-regulation of TRPM6/TRPM7 channels promotes neuroblastoma cell proliferation.
25266063 2015 Prostaglandin E2 promotes MYCN non-amplified neuroblastoma cell survival via ?-catenin stabilization.
25231001 2014 MYCN gene amplification in patients with neuroblastic tumors.
25175806 2014 Drugging MYCN through an allosteric transition in Aurora kinase A.
25164011 2014 MYCN-dependent expression of sulfatase-2 regulates neuroblastoma cell survival.
25142020 2015 ATF4 and N-Myc coordinate glutamine metabolism in MYCN-amplified neuroblastoma cells through ASCT2 activation.
25104850 2014 p19-INK4d inhibits neuroblastoma cell growth, induces differentiation and is hypermethylated and downregulated in MYCN-amplified neuroblastomas.
25100564 2014 Trim32 facilitates degradation of MYCN on spindle poles and induces asymmetric cell division in human neuroblastoma cells.
24993907 2014 Common genes underlying asthma and COPD? Genome-wide analysis on the Dutch hypothesis.
24906397 2014 Effects of a novel long noncoding RNA, lncUSMycN, on N-Myc expression and neuroblastoma progression.
24719420 2014 N-Myc interactor inhibits prototype foamy virus by sequestering viral Tas protein in the cytoplasm.
24608896 2014 SUMOylation of Myc-family proteins.
24603724 2014 TL-118 and gemcitabine drug combination display therapeutic efficacy in a MYCN amplified orthotopic neuroblastoma murine model--evaluation by MRI.
24586304 2014 The novel long noncoding RNA linc00467 promotes cell survival but is down-regulated by N-Myc.
24556696 2014 MYCN gene expression is required for the onset of the differentiation programme in neuroblastoma cells.
24515800 2014 A cell-based high-throughput screen addressing 3'UTR-dependent regulation of the MYCN gene.
24481781 2014 Histone demethylase JARID1B promotes cell proliferation but is downregulated by N-Myc oncoprotein.
24481548 2014 Hypoxia-mediated histone acetylation and expression of N-myc transcription factor dictate aggressiveness of neuroblastoma cells.
24470553 2014 MYCN amplification predicts poor outcome for patients with supratentorial primitive neuroectodermal tumors of the central nervous system .
24419085 2014 GRHL1 acts as tumor suppressor in neuroblastoma and is negatively regulated by MYCN and HDAC3.
24403858 2013 N-Myc differentially regulates expression of MXI1 isoforms in neuroblastoma.
24391509 2014 NCYM, a Cis-antisense gene of MYCN, encodes a de novo evolved protein that inhibits GSK3? resulting in the stabilization of MYCN in human neuroblastomas.
24356251 2013 ALK is a MYCN target gene and regulates cell migration and invasion in neuroblastoma.
24334727 2014 MYCN is a novel oncogenic target in pediatric T-cell acute lymphoblastic leukemia.
24282277 2014 GSK3 inhibitors regulate MYCN mRNA levels and reduce neuroblastoma cell viability through multiple mechanisms, including p53 and Wnt signaling.
24260886 2013 [Methods of detection and prognostic significance of genetic material increase of the short arm of chromosome 2 and a deletion of the short arm of chromosome 1 in patients with neuroblastoma].
24190252 2014 Destabilization of MYC/MYCN by the mitochondrial inhibitors, metaiodobenzylguanidine, metformin and phenformin.
24173829 2014 S(+)-ibuprofen destabilizes MYC/MYCN and AKT, increases p53 expression, and induces unfolded protein response and favorable phenotype in neuroblastoma cell lines.
24130166 2014 MYCN and survivin cooperatively contribute to malignant transformation of fibroblasts.
24011394 2013 Dihydropyrimidinase-like protein 3 expression is negatively regulated by MYCN and associated with clinical outcome in neuroblastoma.
23991020 2013 Gemcitabine eliminates double minute chromosomes from human ovarian cancer cells.
23962557 2013 Targeting GD2 ganglioside and aurora A kinase as a dual strategy leading to cell death in cultures of human neuroblastoma cells.
23901000 2013 Neuroblastoma of undifferentiated subtype, prognostic significance of prominent nucleolar formation, and MYC/MYCN protein expression: a report from the Children's Oncology Group.
23851507 2014 RUNX3 interacts with MYCN and facilitates protein degradation in neuroblastoma.
23812427 2014 Histone deacetylase 5 blocks neuroblastoma cell differentiation by interacting with N-Myc.
23792191 2013 Small molecule inhibitors of aurora-a induce proteasomal degradation of N-myc in childhood neuroblastoma.
23639551 MYCN/LIN28B/Let-7/HMGA2 pathway implicated by meta-analysis of GWAS in suppression of post-natal proliferation thereby potentially contributing to aging.
23578955 2013 MYC and MYCN amplification can be reliably assessed by aCGH in medulloblastoma.
23563570 2013 Changes in MYCN expression in human neuroblastoma cell lines following cisplatin treatment may not be related to MYCN copy numbers.
23539269 2013 Histone H3.3. mutations drive pediatric glioblastoma through upregulation of MYCN.
23498719 2013 Characterisation of retinoblastomas without RB1 mutations: genomic, gene expression, and clinical studies.
23430699 2013 Targeting MYCN in neuroblastoma by BET bromodomain inhibition.
23362253 2013 Physical interaction between MYCN oncogene and polycomb repressive complex 2 (PRC2) in neuroblastoma: functional and therapeutic implications.
23358695 2013 Concurrent AURKA and MYCN gene amplifications are harbingers of lethal treatment-related neuroendocrine prostate cancer.
23341988 2013 Genetic instability and intratumoral heterogeneity in neuroblastoma with MYCN amplification plus 11q deletion.
23320395 2013 Copy number gain of MYCN gene is a recurrent genetic aberration and favorable prognostic factor in Chinese pediatric neuroblastoma patients.
23317189 2012 Chromosome imbalances and alterations of AURKA and MYCN genes in children with neuroblastoma.
23308108 2013 Focal DNA copy number changes in neuroblastoma target MYCN regulated genes.
23284678 2012 Tumor development, growth characteristics and spectrum of genetic aberrations in the TH-MYCN mouse model of neuroblastoma.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23280764 2014 MYCN is recruited to the RASSF1A promoter but is not critical for DNA hypermethylation in neuroblastoma.
23186832 2013 MYCN-mediated overexpression of mitotic spindle regulatory genes and loss of p53-p21 function jointly support the survival of tetraploid neuroblastoma cells.
23152863 2012 Galectin-3 impairment of MYCN-dependent apoptosis-sensitive phenotype is antagonized by nutlin-3 in neuroblastoma cells.
23091029 2012 Functional MYCN signature predicts outcome of neuroblastoma irrespective of MYCN amplification.
23042116 2012 LIN28B induces neuroblastoma and enhances MYCN levels via let-7 suppression.
22975311 2012 Constitutive autotaxin transcription by Nmyc-amplified and non-amplified neuroblastoma cells is regulated by a novel AP-1 and SP-mediated mechanism and abrogated by curcumin.
22921766 CDKL5, a novel MYCN-repressed gene, blocks cell cycle and promotes differentiation of neuronal cells.
22907436 2013 Direct effects of Bmi1 on p53 protein stability inactivates oncoprotein stress responses in embryonal cancer precursor cells at tumor initiation.
22907398 2013 Next-generation RNA sequencing reveals differential expression of MYCN target genes and suggests the mTOR pathway as a promising therapy target in MYCN-amplified neuroblastoma.
22751132 2013 Epigenetic regulation of the neuroblastoma genes, Arid3b and Mycn.
22624711 2012 Distinct neural stem cell populations give rise to disparate brain tumors in response to N-MYC.
22544364 2012 A genome-wide association study identifies susceptibility loci for Wilms tumor.
22484425 2013 MYCN and ALKF1174L are sufficient to drive neuroblastoma development from neural crest progenitor cells.
22439933 2012 Activated ALK collaborates with MYCN in neuroblastoma pathogenesis.
22383024 2013 Successful treatment of infants with localized neuroblastoma based on their MYCN status.
22337647 2012 Segmental chromosome aberrations converge on overexpression of mitotic spindle regulatory genes in high-risk neuroblastoma.
22286764 2012 Anaplastic Lymphoma Kinase (ALK) regulates initiation of transcription of MYCN in neuroblastoma cells.
22218692 2012 Paracrine signaling through MYCN enhances tumor-vascular interactions in neuroblastoma.
22202125 2012 N-Myc regulates expression of the detoxifying enzyme glutathione transferase GSTP1, a marker of poor outcome in neuroblastoma.
22146831 2011 Segmental chromosomal alterations lead to a higher risk of relapse in infants with MYCN-non-amplified localised unresectable/disseminated neuroblastoma (a SIOPEN collaborative study).
22123490 2012 Coamplification of multiple regions of chromosome 2, including MYCN, in a single patchwork amplicon in cancer cell lines.
22120721 2012 Cyclin E1 is a common target of BMI1 and MYCN and a prognostic marker for neuroblastoma progression.
22090452 2012 Prognostic classification of pediatric medulloblastoma based on chromosome 17p loss, expression of MYCC and MYCN, and Wnt pathway activation.
22068108 2011 Direct interaction of Gas41 and Myc encoded by amplified genes in nervous system tumours.
22065083 2012 Antitumor activity of sustained N-myc reduction in rhabdomyosarcomas and transcriptional block by antigene therapy.
22052359 2011 Outcome of the p53-mediated DNA damage response in neuroblastoma is determined by morphological subtype and MYCN expression.
22035742 2011 Array comparative genomic hybridization analysis identifies recurrent gain of chromosome 2p25.3 involving the ACP1 and MYCN genes in chronic lymphocytic leukemia.
21929510 2012 DNA-damaging drug-induced apoptosis sensitized by N-myc in neuroblastoma cells.
21908575 2011 Expression of NLRR3 orphan receptor gene is negatively regulated by MYCN and Miz-1, and its downregulation is associated with unfavorable outcome in neuroblastoma.
21882282 2011 Molecular profiling reveals frequent gain of MYCN and anaplasia-specific loss of 4q and 14q in Wilms tumor.
21862876 2011 Crosstalk between MYCN and MDM2-p53 signal pathways regulates tumor cell growth and apoptosis in neuroblastoma.
21856782 2011 MYCN and MYC regulate tumor proliferation and tumorigenesis directly through BMI1 in human neuroblastomas.
21822304 2012 MDM2 regulates MYCN mRNA stabilization and translation in human neuroblastoma cells.
21796619 2012 Identification of a novel recurrent 1q42.2-1qter deletion in high risk MYCN single copy 11q deleted neuroblastomas.
21796614 2012 Dickkopf-3 is regulated by the MYCN-induced miR-17-92 cluster in neuroblastoma.
21750863 2011 MYCN amplicon junctions as tumor-specific targets for minimal residual disease detection in neuroblastoma.
21731748 2011 Co-localization of the oncogenic transcription factor MYCN and the DNA methyl binding protein MeCP2 at genomic sites in neuroblastoma.
21725357 2012 MYCN sensitizes neuroblastoma to the MDM2-p53 antagonists Nutlin-3 and MI-63.
21698133 2011 SIRT1 promotes N-Myc oncogenesis through a positive feedback loop involving the effects of MKP3 and ERK on N-Myc protein stability.
21646478 2011 Sequential activation of Snail1 and N-Myc modulates sonic hedgehog-induced transformation of neural cells.
21572098 2011 MYCN-regulated miRNA-92 inhibits secretion of the tumor suppressor DICKKOPF-3 (DKK3) in neuroblastoma.
21533284 2011 Deregulation of MYCN, LIN28B and LET7 in a molecular subtype of aggressive high-grade serous ovarian cancers.
21508638 2011 Integrated cytogenetic and high-resolution array CGH analysis of genomic alterations associated with MYCN amplification.
21501490 2011 Exon array analysis reveals neuroblastoma tumors have distinct alternative splicing patterns according to stage and MYCN amplification status.
21498633 2011 A genome-wide search for promoters that respond to increased MYCN reveals both new oncogenic and tumor suppressor microRNAs associated with aggressive neuroblastoma.
21384249 2011 Microgravity assay of neuroblastoma: in vitro aggregation kinetics and organoid morphology correlate with MYCN expression.
21378543 2011 Supratentorial primitive neuroectodermal tumors of the central nervous system in adults: molecular and histopathologic analysis of 12 cases.
21370425 2011 Detection of MYCN DNA in the cerebrospinal fluid for diagnosing isolated central nervous system relapse in neuroblastoma.
21304178 2010 Addiction of MYCN amplified tumours to B-MYB underscores a reciprocal regulatory loop.
21297076 2011 Haplotype association mapping of acute lung injury in mice implicates activin a receptor, type 1.
21288077 Neuroblastomas with discordant genotype-phenotype relationships: report of four cases with MYCN amplification and favorable histology.
21258086 2011 The FRA2C common fragile site maps to the borders of MYCN amplicons in neuroblastoma and is associated with gross chromosomal rearrangements in different cancers.
21224895 2011 Dissection of the MYCN locus in Feingold syndrome and isolated oesophageal atresia.
21214410 2011 Percentage tumor necrosis following chemotherapy in neuroblastoma correlates with MYCN status but not survival.
21173028 2011 MYCN sensitizes human neuroblastoma to apoptosis by HIPK2 activation through a DNA damage response.
21123453 2011 A SP1/MIZ1/MYCN repression complex recruits HDAC1 at the TRKA and p75NTR promoters and affects neuroblastoma malignancy by inhibiting the cell response to NGF.
21112821 2011 N-Myc is a downstream target of RET signaling and is required for transcriptional regulation of p18(Ink4c) by the transforming mutant RET(C634R).
21073496 2011 TP53, ?-Catenin and c-myc/N-myc status in embryonal tumours with ependymoblastic rosettes.
21046119 2011 The genetic and clinical significance of MYCN gain as detected by FISH in neuroblastoma.
20980091 2011 Inhibition of mir-21, which is up-regulated during MYCN knockdown-mediated differentiation, does not prevent differentiation of neuroblastoma cells.
20961996 2010 Combinatorial regulation of neuroblastoma tumor progression by N-Myc and hypoxia inducible factor HIF-1alpha.
20811720 2010 Biological effects of induced MYCN hyper-expression in MYCN-amplified neuroblastomas.
20719933 2010 Meta-analysis of neuroblastomas reveals a skewed ALK mutation spectrum in tumors with MYCN amplification.
20607354 2011 Low-level copy number changes of MYC genes have a prognostic impact in medulloblastoma.
20575024 2010 Analysis of the REL, BCL11A, and MYCN proto-oncogenes belonging to the 2p amplicon in chronic lymphocytic leukemia.
20478998 2010 Pleiotropic role for MYCN in medulloblastoma.
20425471 2010 Etiology of esophageal atresia and tracheoesophageal fistula: "mind the gap".
20424123 2010 Transcriptional repression of SKP2 is impaired in MYCN-amplified neuroblastoma.
20409325 2010 MicroRNA-184 inhibits neuroblastoma cell survival through targeting the serine/threonine kinase AKT2.
20395439 2010 2p24 Gain region harboring MYCN gene compared with MYCN amplified and nonamplified neuroblastoma: biological and clinical characteristics.
20332316 2010 Subtype-specific FBXW7 mutation and MYCN copy number gain in Wilms' tumor.
20236072 2010 Nitric oxide control of MYCN expression and multi drug resistance genes in tumours of neural origin.
20190806 2010 Bmi1 is a MYCN target gene that regulates tumorigenesis through repression of KIF1Bbeta and TSLC1 in neuroblastoma.
20180881 2010 Human neuroblastoma cells with MYCN amplification are selectively resistant to oxidative stress by transcriptionally up-regulating glutamate cysteine ligase.
20179233 2010 Neuroblastoma progression correlates with downregulation of the lymphangiogenesis inhibitor sVEGFR-2.
20173740 2010 miR-9, a MYC/MYCN-activated microRNA, regulates E-cadherin and cancer metastasis.
20145147 2010 p53 is a direct transcriptional target of MYCN in neuroblastoma.
20144241 2010 Extracellular matrix rigidity modulates neuroblastoma cell differentiation and N-myc expression.
20103633 2010 NF-kappaB, and not MYCN, regulates MHC class I and endoplasmic reticulum aminopeptidases in human neuroblastoma cells.
20080637 2010 MYCN-regulated microRNAs repress estrogen receptor-alpha (ESR1) expression and neuronal differentiation in human neuroblastoma.
20017904 2009 Upstream ORF affects MYCN translation depending on exon 1b alternative splicing.
20007697 2010 Opposing effects of two tissue transglutaminase protein isoforms in neuroblastoma cell differentiation.
19997598 2009 Global MYCN transcription factor binding analysis in neuroblastoma reveals association with distinct E-box motifs and regions of DNA hypermethylation.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19946337 2010 MYCN/c-MYC-induced microRNAs repress coding gene networks associated with poor outcome in MYCN/c-MYC-activated tumors.
19924232 2009 Widespread dysregulation of MiRNAs by MYCN amplification and chromosomal imbalances in neuroblastoma: association of miRNA expression with survival.
19885598 2009 High level MycN expression in non-MYCN amplified neuroblastoma is induced by the combination treatment nutlin-3 and doxorubicin and enhances chemosensitivity.
19852433 2009 A Feingold syndrome case with previously undescribed features and a new mutation.
19766596 2009 Positive auto-regulation of MYCN in human neuroblastoma.
19724862 2009 MycN is a transcriptional regulator of livin in neuroblastoma.
19656550 2009 Aberrant copy numbers of ALK gene is a frequent genetic alteration in neuroblastomas.
19649205 2009 Mdm2 deficiency suppresses MYCN-Driven neuroblastoma tumorigenesis in vivo.
19615087 2009 Regulation of MYCN expression in human neuroblastoma cells.
19608868 2009 MYCN promotes the expansion of Phox2B-positive neuronal progenitors to drive neuroblastoma development.
19495417 2009 N-Myc regulates expression of pluripotency genes in neuroblastoma including lif, klf2, klf4, and lin28b.
19401549 2009 Clusterin, a haploinsufficient tumor suppressor gene in neuroblastomas.
19301388 2009 Influence of neuroblastoma stage on serum-based detection of MYCN amplification.
19208763 2009 Expression of the proneural gene encoding Mash1 suppresses MYCN mitotic activity.
19111882 2009 Stabilization of N-Myc is a critical function of Aurora A in human neuroblastoma.
19061778 2009 Centrosome amplification is correlated with ploidy divergence, but not with MYCN amplification, in neuroblastoma tumors.
19047152 2008 ODC1 is a critical determinant of MYCN oncogenesis and a therapeutic target in neuroblastoma.
19047142 2008 N-Myc regulates a widespread euchromatic program in the human genome partially independent of its role as a classical transcription factor.
19006223 2009 Analysis of biological prognostic factors using tissue microarrays in neuroblastic tumors.
18955045 2008 Regulation of CRABP-II expression by MycN in Wilms tumor.
18949372 2008 Vasoactive intestinal peptide decreases MYCN expression and synergizes with retinoic acid in a human MYCN-amplified neuroblastoma cell line.
18851746 2008 Distinct transcriptional MYCN/c-MYC activities are associated with spontaneous regression or malignant progression in neuroblastomas.
18785023 2008 Genomic differences between retinoma and retinoblastoma.
18769732 2008 Binomial mitotic segregation of MYCN-carrying double minutes in neuroblastoma illustrates the role of randomness in oncogene amplification.
18671284 2008 Feingold syndrome associated with two novel MYCN mutations in sporadic and familial cases including monozygotic twins.
18610847 [Transcription levels of the MYCN gene in blood cell subpopulations of Patients with leukemia].
18591937 2008 N-MYC promotes cell proliferation through a direct transactivation of neuronal leucine-rich repeat protein-1 (NLRR1) gene in neuroblastoma.
18504438 2008 The MYCN oncogene is a direct target of miR-34a.
18488021 2008 The HECT-domain ubiquitin ligase Huwe1 controls neural differentiation and proliferation by destabilizing the N-Myc oncoprotein.
18470948 2008 Genotype-phenotype correlations in MYCN-related Feingold syndrome.
18391076 2008 Translocations targeting CCND2, CCND3, and MYCN do occur in t(11;14)-negative mantle cell lymphomas.
18348317 2008 Fast detection of MYCN copy number alterations in brain neuronal tumors by real-time PCR.
18335505 2008 Identification of PAX3-FKHR-regulated genes differentially expressed between alveolar and embryonal rhabdomyosarcoma: focus on MYCN as a biologically relevant target.
18281664 2008 Clinical significance of MYCN amplification and ploidy in favorable-stage neuroblastoma: a report from the Children's Oncology Group.
18278068 2008 N-myc is a novel regulator of PI3K-mediated VEGF expression in neuroblastoma.
18198336 2008 N-myc coordinates retinal growth with eye size during mouse development.
18165268 2008 Genes proximal and distal to MYCN are highly expressed in human neuroblastoma as visualized by comparative expressed sequence hybridization.
18097563 2008 Keratoepithelin reverts the suppression of tissue factor pathway inhibitor 2 by MYCN in human neuroblastoma: a mechanism to inhibit invasion.
18059033 2008 Dickkopf-3 expression is a marker for neuroblastic tumor maturation and is down-regulated by MYCN.
18004567 2008 MYCN as a target for cancer immunotherapy.
17710228 2007 Oncogene MYCN regulates localization of NKT cells to the site of disease in neuroblastoma.
17704800 2008 An N-Myc truncation analogous to c-Myc-S induces cell proliferation independently of transactivation but dependent on Myc homology box II.
17643814 2007 Dickkopf-1 is down-regulated by MYCN and inhibits neuroblastoma cell proliferation.
17611020 2007 Concomitant DDX1 and MYCN gain in neuroblastoma.
17554788 2008 Retinoic acid induced downregulation of MYCN is not mediated through changes in Sp1/Sp3.
17535087 A case of composite neuroblastoma composed of histologically and biologically distinct clones.
17525631 2007 Association of MYCN amplification and 1p deletion in neuroblastomas with high tumor vascularity.
17506115 2007 1H MRS identifies specific metabolite profiles associated with MYCN-amplified and non-amplified tumour subtypes of neuroblastoma cell lines.
17495526 2007 Cell cycle regulation targets of MYCN identified by gene expression microarrays.
17464317 2007 Expression of MYCN in pediatric synovial sarcoma.
17327229 2007 N-MYC regulates focal adhesion kinase expression in human neuroblastoma.
17311883 2007 The Trithorax group protein Lid is a trimethyl histone H3K4 demethylase required for dMyc-induced cell growth.
17289033 2007 p14ARF interacts with N-Myc and inhibits its transcriptional activity.
17213019 2007 Correlation of modified Shimada classification with MYCN and 1p36 status detected by fluorescence in situ hybridization in neuroblastoma.
17172827 2006 The role of MYCN in the failure of MYCN amplified neuroblastoma cell lines to G1 arrest after DNA damage.
17055458 2006 MYCN silencing induces differentiation and apoptosis in human neuroblastoma cells.
17023822 2006 Pilot study to evaluate MYCN expression as a neuroblastoma cell marker to detect minimal residual disease by RT-PCR.
17020972 2006 Does MYCN amplification manifested as homogeneously staining regions at diagnosis predict a worse outcome in children with neuroblastoma? A Children's Oncology Group study.
16912192 2006 Inhibition of phosphatidylinositol 3-kinase destabilizes Mycn protein and blocks malignant progression in neuroblastoma.
16912187 2006 Cellular retinoic acid-binding protein II is a direct transcriptional target of MycN in neuroblastoma.
16906565 2006 Expanding the clinical spectrum of MYCN-related Feingold syndrome.
16596176 2006 Recurrent NMYC copy number gain and high protein expression in basal cell carcinoma.
16516635 2006 Biological diagnosis for neuroblastoma using the combination of highly sensitive analysis of prognostic factors.
16278682 2006 Loss of one HuD allele on chromosome #1p selects for amplification of the N-myc proto-oncogene in human neuroblastoma cells.
16166307 2005 High mobility group A1 is a molecular target for MYCN in human neuroblastoma.
15833843 2005 Inhibition of a new differentiation pathway in neuroblastoma by copy number defects of N-myc, Cdc42, and nm23 genes.
15821734 2005 MYCN haploinsufficiency is associated with reduced brain size and intestinal atresias in Feingold syndrome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15660126 2005 Positive and negative regulation of EAAT2 by NF-kappaB: a role for N-myc in TNFalpha-controlled repression.
15644444 2005 The p53 regulatory gene MDM2 is a direct transcriptional target of MYCN in neuroblastoma.
15632181 2005 Linking of N-Myc to death receptor machinery in neuroblastoma cells.
15547663 2004 Investigation of MYCN status in neuroblastoma by fluorescence in situ hybridization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15331636 2004 Nitric oxide negatively regulates proliferation and promotes neuronal differentiation through N-Myc downregulation.
15316056 2004 Clustering of gene hypermethylation associated with clinical risk groups in neuroblastoma.
15314226 2004 Mechanisms of embryonal tumor initiation: distinct roles for MycN expression and MYCN amplification.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15258910 2004 Expression and DNA-binding activity of MYCN/Max and Mnt/Max during induced differentiation of human neuroblastoma cells.
15218241 2004 Evolution of unbalanced gain of distal chromosome 2p in neuroblastoma.
15198123 2004 Histopathological and molecular prognostic markers in medulloblastoma: c-myc, N-myc, TrkC, and anaplasia.
15117961 2004 Nestin is a potential mediator of malignancy in human neuroblastoma cells.
14737110 2004 MYCN-mediated regulation of the MRP1 promoter in human neuroblastoma.
14719101 2004 Targeted inhibition of NMYC by peptide nucleic acid in N-myc amplified human neuroblastoma cells: cell-cycle inhibition with induction of neuronal cell differentiation and apoptosis.
14647433 2004 Enhanced expression of MYCN leads to centrosome hyperamplification after DNA damage in neuroblastoma cells.
14645238 2004 E2F and Sp1/Sp3 Synergize but are not sufficient to activate the MYCN gene in neuroblastomas.
12907629 2003 Genome-wide analysis of gene expression associated with MYCN in human neuroblastoma.
12819037 2003 MYCN enhances P-gp/MDR1 gene expression in the human metastatic neuroblastoma IGR-N-91 model.
12808116 2003 Expression of trkB in human neuroblastoma in relation to MYCN expression and retinoic acid treatment.
12670915 2003 ID2 expression is not associated with MYCN amplification or expression in human neuroblastomas.
12660036 2003 Molecular cytogenetic analysis of a pleuropulmonary blastoma.
12569580 2003 Rapamycin inhibits proliferation of human neuroblastoma cells without suppression of MycN.
12545167 2003 ID2 expression in neuroblastoma does not correlate to MYCN levels and lacks prognostic value.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438307 2003 E2F proteins regulate MYCN expression in neuroblastomas.
12232763 2002 High level amplification of N-MYC is not associated with adverse histology or outcome in primary retinoblastoma tumours.
12219017 2002 Importance of Sp1 consensus motifs in the MYCN promoter.
12192602 N-myc modulates expression of p73 in neuroblastoma.
12153570 2002 N-myc oncogene overexpression down-regulates leukemia inhibitory factor in neuroblastoma.
11881792 2002 Neuroblastoma: a single institution's experience with 128 children and an evaluation of clinical and biological prognostic factors.
11861392 2002 Minichromosome maintenance protein MCM7 is a direct target of the MYCN transcription factor in neuroblastoma.
11850545 2002 Quantification of MYCN, DDX1, and NAG gene copy number in neuroblastoma using a real-time quantitative PCR assay.
11602341 2001 Function and regulation of the transcription factors of the Myc/Max/Mad network.
11593398 2001 Functional interaction of Yaf2 with the central region of MycN.
11420678 2001 N-myc translation is initiated via an internal ribosome entry segment that displays enhanced activity in neuronal cells.
10677303 2000 Familial syndromic esophageal atresia maps to 2p23-p24.
10597290 1999 Nmi protein interacts with regions that differ between MycN and Myc and is localized in the cytoplasm of neuroblastoma cells in contrast to nuclear MycN.
10407192 1999 Interferon-gamma induces proliferation but not apoptosis in murine astrocytes through the differential expression of the myc proto-oncogene family.
10229200 1999 Differential effects of the widely expressed dMax splice variant of Max on E-box vs initiator element-mediated regulation by c-Myc.
9856457 1998 Growth arrest failure, G1 restriction point override, and S phase death of sensory precursor cells in the absence of neurotrophin-3.
8668343 1996 Isolation and characterization of Nmi, a novel partner of Myc proteins.
6728001 1984 Expression and amplification of the N-myc gene in primary retinoblastoma.
6719137 1984 Amplification of N-myc in untreated human neuroblastomas correlates with advanced disease stage.
6700732 1984 Chromosome localization in normal human cells and neuroblastomas of a gene related to c-myc.
6575396 1983 Isolation of amplified DNA sequences from IMR-32 human neuroblastoma cells: facilitation by fluorescence-activated flow sorting of metaphase chromosomes.
3940169 1986 Gene amplification in human neuroblastomas: basic mechanisms and clinical implications.
3796607 1986 Human proto-oncogene N-myc encodes nuclear proteins that bind DNA.
3552210 1987 Expression of N-myc and c-src during the development of fetal human brain.
3510398 1986 Human N-myc is closely related in organization and nucleotide sequence to c-myc.
3437890 1987 Alternative processing of RNA transcribed from NMYC.
3299258 1987 Novel non-isotopic in situ hybridization technique detects small (1 Kb) unique sequences in routinely G-banded human chromosomes: fine mapping of N-myc and beta-NGF genes.
3008339 1986 Identification and characterization of the protein encoded by the human N-myc oncogene.
2987858 1985 Nucleotide sequence of the 3' exon of the human N-myc gene.
2869488 1986 Nucleotide sequence of the human N-myc gene.
2834684 1988 Sequence of a germ-line N-myc gene and amplification as a mechanism of activation.
2582423 1985 N-myc amplification in multiple homogeneously staining regions in two human neuroblastomas.
2006410 1991 Max: a helix-loop-helix zipper protein that forms a sequence-specific DNA-binding complex with Myc.
1695323 1990 N-myc mRNA forms an RNA-RNA duplex with endogenous antisense transcripts.
1549498 1992 Dinucleotide repeat polymorphism at the human hemoglobin alpha-1 pseudo-gene (HBAP1).
1425701 1992 Specific phosphorylation of the acidic central region of the N-myc protein by casein kinase II.
1419902 1992 Isolation and characterization of complementary DNA for N-cym, a gene encoded by the DNA strand opposite to N-myc.