Property Summary

NCBI Gene PubMed Count 37
PubMed Score 403.77
PubTator Score 182.82

Knowledge Summary

Patent

No data available

Expression

Pathway (1)

Gene RIF (27)

PMID Text
25528583 These results suggest that Mycl1 expression might be useful as a biomarker to predict prognosis and is a promising therapeutic target for patients with gastric cancer.
23349019 Several tagging SNPs and haplotypes in TRIT1, MYCL1 and MFSD2A region are significantly associated with risk and clinicopathological features of gastric cancer in a Chinese population.
22490849 The polymorphism of H-ras and L-myc genes is not related to colorectal cancer risk, but there is a synergy between H-ras and L-myc polymorphisms in the development of rectal cancer.
21676885 MYCL1 is the target of hsa-miR-1827. A rs3134615 G>T SNP in the 3'-UTR altered regulation of MYCL1 expression. This SNP was associated with increased susceptibility to SCLC, possibly resulting from attenuated interaction with the miRNA hsa-miR-1827.
20874233 The results demonstrate that MYCL1 rs3134613 is associated with susceptibility to diffuse-type gastric cancer and with differentiation of gastric cancer.
20095854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536170 Meta-analysis of gene-disease association. (HuGE Navigator)
19020549 L-Myc may have a role in Merkel cell carcinoma pathogenesis
18645122 The L-myc gene polymorphism may help detect and prevent HNNMSC and LLC in susceptible individuals. It may also contribute to estimation of tumor behavior in patients with HNNMSC.
18645122 Observational study of gene-disease association. (HuGE Navigator)
18566574 L-myc gene polymorphism may have a role in risk of thyroid cancer
17145094 Observational study of gene-disease association. (HuGE Navigator)
17145094 polymorphisms in the MYCL1 LD region affect lung cancer survival but that the functional element(s) may show population-specific patterns
15269151 Meta-analysis of gene-disease association. (HuGE Navigator)
15075794 Observational study of gene-disease association. (HuGE Navigator)
15014029 Colorectal tumor patients whose tumors exhibited loss of heterozygosity at MYCL1 at chromosome 1p34 were likely to have a poor prognosis.
12883749 Observational study of gene-disease association. (HuGE Navigator)
12507230 Observational study of gene-disease association. (HuGE Navigator)
12439118 Observational study of gene-disease association. (HuGE Navigator)
12169206 MYCL1, FHIT, SPARC, p16(INK4) and TP53 genes associated to lung cancer in idiopathic pulmoary fibrosis
12034523 Observational study of gene-disease association. (HuGE Navigator)
11956626 Allelic deletions of L-myc in urine from bladder cancer patients
11955646 Observational study of gene-disease association. (HuGE Navigator)
11836605 L-myc proto oncogene RFLP is associated with lung adenocarcinoma
11802801 Observational study of gene-disease association. (HuGE Navigator)
11802801 L-myc polymorphism may affect the induction of lung cancer by smoking
11473723 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTG      1 - 70
DEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNP     71 - 140
APAAPCPLGEPKTQACSGSESPSDSENEEIDVVTVEKRQSLGIRKPVTITVRADPLDPCMKHFHISIHQQ    141 - 210
QHNYAARFPPESCSQEEASERGPQEEVLERDAAGEKEDEEDEEIVSPPPVESEAAQSCHPKPVSSDTEDV    211 - 280
TKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCR    281 - 350
QQQLQKRIAYLTGY                                                            351 - 364
//

Text Mined References (38)

PMID Year Title
25528583 2015 Expression and prognostic value of Mycl1 in gastric cancer.
23349019 2013 Association of polymorphisms and haplotype in the region of TRIT1, MYCL1 and MFSD2A with the risk and clinicopathological features of gastric cancer in a southeast Chinese population.
22490849 2012 [Association between H-ras and L-myc gene polymorphisms and susceptibility to colorectal cancer].
21676885 2011 Genetic variation in an miRNA-1827 binding site in MYCL1 alters susceptibility to small-cell lung cancer.
20874233 2010 Association of a MYCL1 single nucleotide polymorphism, rs3134613, with susceptibility to diffuse-type gastric cancer and with differentiation of gastric cancer in a southeast Chinese population.
20095854 2010 Novel breast cancer risk alleles and interaction with ionizing radiation among U.S. radiologic technologists.
19536170 2009 Cell proliferation-related genetic polymorphisms and gastric cancer risk: systematic review and meta-analysis.
19020549 2009 Array-CGH reveals recurrent genomic changes in Merkel cell carcinoma including amplification of L-Myc.
18645122 2008 L-myc polymorphism in head and neck nonmelanoma skin and lower lip cancers.
18566574 2008 L-myc gene polymorphism and risk of thyroid cancer.
17145094 2007 Ethnic differences in frequencies of gene polymorphisms in the MYCL1 region and modulation of lung cancer patients' survival.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15269151 2004 Meta-analysis suggests association of L-myc EcoRI polymorphism with cancer prognosis.
15075794 2004 A new polymorphism (Ser362Thr) of the L-myc gene is not associated with lung adenocarcinoma risk and prognosis.
15014029 2004 Allelic loss of a common microsatellite marker MYCL1: a useful prognostic factor of poor outcomes in colorectal cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12883749 Genetic polymorphisms and susceptibility to esophageal cancer among Chinese population (review).
12707044 2003 Amplification and overexpression of the L-MYC proto-oncogene in ovarian carcinomas.
12507230 2002 Close correlation between restriction fragment length polymorphism of L-myc gene and susceptibility to gastric cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12439118 2002 EcoRI polymorphism of the L-myc gene in gastric cancer patients.
12169206 MYCL1, FHIT, SPARC, p16(INK4) and TP53 genes associated to lung cancer in idiopathic pulmonary fibrosis.
12034523 2002 Is there any correlation between restriction fragment length polymorphism of the L-MYC gene and metastasis of human nonsmall cell lung cancer?
11956626 Allelic deletions of Rb and L-myc in urine sediments from patients with bladder tumors or carcinoma in situ.
11955646 2002 Association of L-myc polymorphism with lung cancer susceptibility and prognosis in relation to age-selected controls and stratified cases.
11836605 L-myc restriction fragment length polymorphism and histological pattern of invasion in lung adenocarcinoma.
11802801 2002 L-myc genotype is associated with different susceptibility to lung cancer in smokers.
11602341 2001 Function and regulation of the transcription factors of the Myc/Max/Mad network.
11473723 2001 Different susceptibility of each L-myc genotype to esophageal cancer risk factors.
10597290 1999 Nmi protein interacts with regions that differ between MycN and Myc and is localized in the cytoplasm of neuroblastoma cells in contrast to nuclear MycN.
10229200 1999 Differential effects of the widely expressed dMax splice variant of Max on E-box vs initiator element-mediated regulation by c-Myc.
8978772 1996 Reassignment of MYCL1 to human chromosome 1p34.3 by fluorescence in situ hybridization.
7479755 1995 Myc and Max: molecular evolution of a family of proto-oncogene products and their dimerization partner.
3322939 1987 The human myc gene family: structure and activity of L-myc and an L-myc pseudogene.
3054516 1988 The human L-myc gene encodes multiple nuclear phosphoproteins from alternatively processed mRNAs.
2827002 1988 Structure and expression of the human L-myc gene reveal a complex pattern of alternative mRNA processing.
2548855 1989 The human L-myc gene is expressed as two forms of protein in small cell lung carcinoma cell lines: detection by monoclonal antibodies specific to two myc homology box sequences.