Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.62
PubTator Score 12.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Adenoid Cystic Carcinoma 99
Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.1e-07

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.300 1.1e-07

Gene RIF (9)

PMID Text
22050566 c-Myc expression is reduced in pterygium compared with normal conjunctiva.
20562918 miR-22 acts as a tumor suppressor through direct repression of MYCBP expression and subsequent reduction of oncogenic c-Myc activities.
20544396 Suppression of telomerase activity mediated by PinX1 is involved in the Mad1/c-Myc pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17595061 An important role for MBP-1 in the altered cell proliferation and energy utilization that occur in response to an altered glucose concentration.
16866877 AMY-1 coordinates ADP-Ribosylation Factors-mediated membrane trafficking and signaling pathways.
12414807 interacts with S-AKAP84 and AKAP95 in the cytoplasm and the nucleus, respectively, and inhibits enzyme acdtivity by preventing binding of its catalytic subunit to A-kinase-anchoring protein (AKAP) complex
12223483 identified a novel AMY-1-binding protein, AAT-1, and determied its expression profiles, genes, and cellular localization; results showed that AAT-1 was specifically expressed in the testis throughout spermatogenesis and was also present in mature sperm
11483602 AMY-1 was localized in the mitochondria of HeLa and sperm in association with AKAP149 and S-AKAP84, respectively. These results suggest that AMY-1 plays a role in spermatogenesis

AA Sequence

MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELA      1 - 70
EMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE                                          71 - 103
//

Text Mined References (22)

PMID Year Title
22050566 2011 Downregulation of c-Myc in pterygium and cultured pterygial cells.
20562918 2010 Tumor-suppressive microRNA-22 inhibits the transcription of E-box-containing c-Myc target genes by silencing c-Myc binding protein.
20544396 2010 PinX1 inhibits telomerase activity in gastric cancer cells through Mad1/c-Myc pathway.
20500816 2010 Genomic profiling of tumor initiating prostatospheres.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17595061 2007 c-myc promoter binding protein regulates the cellular response to an altered glucose concentration.
16866877 2006 AMY-1 (associate of Myc-1) localization to the trans-Golgi network through interacting with BIG2, a guanine-nucleotide exchange factor for ADP-ribosylation factors.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15979100 2005 Identification of MYCBP as a beta-catenin/LEF-1 target using DNA microarray analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12522145 2003 Identification of targets for calcium signaling through the copine family of proteins. Characterization of a coiled-coil copine-binding motif.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414807 2002 AMY-1 interacts with S-AKAP84 and AKAP95 in the cytoplasm and the nucleus, respectively, and inhibits cAMP-dependent protein kinase activity by preventing binding of its catalytic subunit to A-kinase-anchoring protein (AKAP) complex.
12223483 2002 AAT-1, a novel testis-specific AMY-1-binding protein, forms a quaternary complex with AMY-1, A-kinase anchor protein 84, and a regulatory subunit of cAMP-dependent protein kinase and is phosphorylated by its kinase.
12151104 2002 AMAP-1, a novel testis-specific AMY-1-binding protein, is differentially expressed during the course of spermatogenesis.
11483602 2001 AMY-1, a c-Myc-binding protein, is localized in the mitochondria of sperm by association with S-AKAP84, an anchor protein of cAMP-dependent protein kinase.
9797456 1998 AMY-1, a novel C-MYC binding protein that stimulates transcription activity of C-MYC.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.