Property Summary

NCBI Gene PubMed Count 35
PubMed Score 19.98
PubTator Score 15.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (14)

Disease log2 FC p
Astrocytoma, Pilocytic -2.900 1.0e-06
atypical teratoid / rhabdoid tumor -3.700 8.2e-09
Breast cancer -3.100 1.9e-05
ependymoma -3.300 1.6e-12
glioblastoma -2.000 1.6e-03
group 3 medulloblastoma -4.400 2.5e-05
intraductal papillary-mucinous adenoma (... 1.700 4.3e-02
intraductal papillary-mucinous neoplasm ... 2.600 2.1e-02
lung adenocarcinoma 1.100 1.1e-02
medulloblastoma, large-cell -3.600 3.5e-05
pediatric high grade glioma -2.500 3.6e-04
Pick disease 1.100 3.1e-03
primitive neuroectodermal tumor -3.400 3.0e-05
psoriasis -1.300 8.0e-09

Gene RIF (14)

AA Sequence

MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVK      1 - 70
VGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNY     71 - 140
RCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDV    141 - 210
WELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPK    211 - 280
LEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLED    281 - 350
TTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG    351 - 420
QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVI    421 - 490
ANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWS    491 - 560
RGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE    561 - 630
VGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI    631 - 700
GISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDEN    701 - 770
GEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIR    771 - 840
IPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYD    841 - 910
LQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFT    911 - 980
VIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFT    981 - 1050
QPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCK   1051 - 1120
AVNDLGTVEIECKLEVKVIAQ                                                    1121 - 1141
//

Text Mined References (39)

PMID Year Title