Property Summary

NCBI Gene PubMed Count 83
PubMed Score 169.01
PubTator Score 125.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Disease Target Count Z-score Confidence
Cancer 2388 4.064 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.500 4.5e-08
group 3 medulloblastoma 1.200 1.8e-03
invasive ductal carcinoma 1.100 2.8e-03
lung adenocarcinoma 1.400 3.4e-13
malignant mesothelioma 2.700 2.6e-08
medulloblastoma, large-cell 1.300 1.6e-05
non-small cell lung cancer 1.890 5.5e-28
psoriasis 1.500 1.9e-04

Gene RIF (46)

AA Sequence

MSRRTRCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWKFLASHFPNRTDQQCQ      1 - 70
YRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQCRERWHNHLNPEVKKSCWTE     71 - 140
EEDRIICEAHKVLGNRWAEIAKMLPGRTDNAVKNHWNSTIKRKVDTGGFLSESKDCKPPVYLLLELEDKD    141 - 210
GLQSAQPTEGQGSLLTNWPSVPPTIKEEENSEEELAAATTSKEQEPIGTDLDAVRTPEPLEEFPKREDQE    211 - 280
GSPPETSLPYKWVVEAANLLIPAVGSSLSEALDLIESDPDAWCDLSKFDLPEEPSAEDSINNSLVQLQAS    281 - 350
HQQQVLPPRQPSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGGSGIGTPPSVLKRQRKRRVAL    351 - 420
SPVTENSTSLSFLDSCNSLTPKSTPVKTLPFSPSQFLNFWNKQDTLELESPSLTSTPVCSQKVVVTTPLH    421 - 490
RDKTPLHQKHAAFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLPQTPHLEEDLKEVLRSEAGIELIIE    491 - 560
DDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMSTLPKSLSLPTTAPSNSSSLTLSGIKEDNSL    561 - 630
LNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS    631 - 700
//

Text Mined References (93)

PMID Year Title