Property Summary

NCBI Gene PubMed Count 10
PubMed Score 99.36
PubTator Score 38.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 1.7e-02
glioblastoma multiforme 1.200 1.4e-10
oligodendroglioma 1.200 3.5e-06
medulloblastoma 1.100 1.6e-03
medulloblastoma, large-cell -1.200 2.1e-03
primitive neuroectodermal tumor 1.100 1.2e-02
juvenile dermatomyositis -1.289 1.1e-12
adrenocortical carcinoma 3.425 2.5e-10
tuberculosis and treatment for 3 months 1.800 3.5e-05
intraductal papillary-mucinous neoplasm ... 1.800 5.1e-03
lung cancer -1.700 6.3e-03
sarcoidosis 1.300 8.9e-03
adult high grade glioma -1.300 2.1e-03
primary Sjogren syndrome 2.000 9.8e-04
Breast cancer 1.700 3.4e-04
lung carcinoma -1.800 1.3e-14
breast carcinoma 1.400 6.7e-16
ovarian cancer 1.200 3.2e-03
head and neck cancer -1.400 2.4e-02

Protein-protein Interaction (3)

Gene RIF (3)

PMID Text
26631609 Our study defines new molecular subclasses of ACC characterized by MYBL1 rearrangements and 5'-NFIB gene fusions.
25940947 Thus, the LIMD1-MYBL1 Index had considerable clinical value for DLBCL subtype classification and prognosis.
23633565 analysis of genetic alterations in MYBL1 in diffuse pediatric low-grade gliomas

AA Sequence

MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLVEQHGTDDWTLIASHLQNRSD      1 - 70
FQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSLIAKHLKGRIGKQCRERWHNHLNPEVKKS     71 - 140
SWTEEEDRIIYEAHKRLGNRWAEIAKLLPGRTDNSIKNHWNSTMRRKVEQEGYLQDGIKSERSSSKLQHK    141 - 210
PCAAMDHMQTQNQFYIPVQIPGYQYVSPEGNCIEHVQPTSAFIQQPFIDEDPDKEKKIKELEMLLMSAEN    211 - 280
EVRRKRIPSQPGSFSSWSGSFLMDDNMSNTLNSLDEHTSEFYSMDENQPVSAQQNSPTKFLAVEANAVLS    281 - 350
SLQTIPEFAETLELIESDPVAWSDVTSFDISDAAASPIKSTPVKLMRIQHNEGAMECQFNVSLVLEGKKN    351 - 420
TCNGGNSEAVPLTSPNIAKFSTPPAILRKKRKMRVGHSPGSELRDGSLNDGGNMALKHTPLKTLPFSPSQ    421 - 490
FFNTCPGNEQLNIENPSFTSTPICGQKALITTPLHKETTPKDQKENVGFRTPTIRRSILGTTPRTPTPFK    491 - 560
NALAAQEKKYGPLKIVSQPLAFLEEDIREVLKEETGTDLFLKEEDEPAYKSCKQENTASGKKVRKSLVLD    561 - 630
NWEKEESGTQLLTEDISDMQSENRFTTSLLMIPLLEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNPNTS    631 - 700
KVVKLEKNLQSNCEWETVVYGKTEDQLIMTEQARRYLSTYTATSSTSRALIL                      701 - 752
//

Text Mined References (16)

PMID Year Title
26631609 2016 Novel MYBL1 Gene Rearrangements with Recurrent MYBL1-NFIB Fusions in Salivary Adenoid Cystic Carcinomas Lacking t(6;9) Translocations.
25940947 2015 Identification and validation of a two-gene expression index for subtype classification and prognosis in Diffuse Large B-Cell Lymphoma.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23633565 2013 Genomic analysis of diffuse pediatric low-grade gliomas identifies recurrent oncogenic truncating rearrangements in the transcription factor MYBL1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17531812 2007 Evolutionarily conserved multisubunit RBL2/p130 and E2F4 protein complex represses human cell cycle-dependent genes in quiescence.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8058310 1994 The human A-myb protein is a strong activator of transcription.
7987850 1994 DNA binding and transactivation activity of A-myb, a c-myb-related gene.
7821437 1995 Human A-myb gene encodes a transcriptional activator containing the negative regulatory domains.
3060855 1988 Isolation of human cDNA clones of myb-related genes, A-myb and B-myb.
2065336 1991 Chromosome locations of the MYB related genes, AMYB and BMYB.