Property Summary

NCBI Gene PubMed Count 48
PubMed Score 20.83
PubTator Score 130.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 8.0e-05
Disease Target Count Z-score Confidence
Choroid Plexus Papilloma 10 3.446 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.208 8.0e-05

Protein-protein Interaction (9)

Gene RIF (23)

PMID Text
26044764 We propose that the nucleolus functions as a stress sensor to modulate p53 protein levels and its acetylation status, determining cell fate between cell cycle arrest and apoptosis by regulating MYBBP1A translocation.
25543088 MYBBP1A(low)AKT(Ser473)(high) staining pattern serves not only as a marker for the pre-senescent stage but also as an indicator of OPSCC patients at high risk for treatment failure.
25303791 TPPII, MYBBP1A and CDK2 form a protein-protein interaction network.
25010285 Tandem affinity purification and mass spectrometry analysis identify MYB binding protein 1a (MYBBP1A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
24375404 MYBBP1A functions to enhance p53 tetramerization that is necessary for p53 activation.
24134843 Mybbp1a is a novel negative regulator of Sirt7.
23583237 MYBBP1A-p53 binding property can account for efficient p53-activation by MYBBP1A under nucleolar stress. Our results support the idea that MYBBP1A plays catalytic roles in p53 acetylation and activation
23388179 Suggest that MYBBP1A is required for p53 activation during anoikis; therefore, it is involved in suppressing colony formation and the tumorigenesis of breast cancer cells.
23209159 Regulators, including BCL11A, MYB, and KLF1, hold great promise to develop targeted and more effective approaches for HbF induction.
23129390 Study suggests that a combination of SP110 and MYBBP1A gene polymorphisms may serve as a novel marker for identifying the risk of developing TB in the Chinese Han population.
23125841 Tandem affinity purification and mass spectrometry analysis identify MYB binding protein 1a (MYBBP1A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23056166 Data show that down-regulation of MYBBP1A decreases the growth rate of wild type mouse embryonic stem cells, embryo fibroblasts (MEFs) and of human HeLa cells, where it also promotes apoptosis.
22686419 Results from our present work reveal a previously unrecognized co-repressor role of Mybbp1a in rRNA expression.
22645127 Mybbp1a may play a dual role in the rRNA metabolism, potentially linking and coordinating ribosomal DNA transcription and pre-rRNA processing to allow for the efficient synthesis of ribosomes.
22339894 We provide experimental evidence that MYBBP1A is an important molecular switch in the regulation of tumor cell proliferation versus migration in head and neck squamous cell carcinoma cells.
22174317 Tandem affinity purification and mass spectrometry analysis identify MYB binding protein 1a (MYBBP1A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21297583 When rRNA transcription was suppressed by nucleolar stress, MYBBP1A translocated to the nucleoplasm and facilitated p53-p300 interaction to enhance p53 acetylation.
20177074 identified MYBBP1A as a novel Aurora B substrate and serine 1303 as the major phosphorylation site
19928837 Myb-binding protein 1a was identified in anti-SMN pulldowns as interacting with SMN proteins.
19276281 SRC-1 is a strong independent predictor of reduced disease free survival, whereas the interactions of the p160 proteins with estrogen receptor alpha can predict the response of patients to endocrine treatment.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18059336 Expression of Ets-2, SRC-1 and c-Myc individually are all associated with reduced disease-free survival in breast cancer
17196614 These results indicate that MYBBP1a is a novel NF-kappaB co-repressor of transcription that competes with p300 and may function to regulate cell type specific genes.

AA Sequence

MESRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLAATEKLLEYLRGRPKGSEM      1 - 70
KYALKRLITGLGVGRETARPCYSLALAQLLQSFEDLPLCSILQQIQEKYDLHQVKKAMLRPALFANLFGV     71 - 140
LALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKALVDILSEVSKATLQEILPEVLKADLNIILS    141 - 210
SPEQLELFLLAQQKVPSKLKKLVGSVNLFSDENVPRLVNVLKMAASSVKKDRKLPAIALDLLRLALKEDK    211 - 280
FPRFWKEVVEQGLLKMQFWPASYLCFRLLGAALPLLTKEQLHLVMQGDVIRHYGEHVCTAKLPKQFKFAP    281 - 350
EMDDYVGTFLEGCQDDPERQLAVLVAFSSVTNQGLPVTPTFWRVVRFLSPPALQGYVAWLRAMFLQPDLD    351 - 420
SLVDFSTNNQKKAQDSSLHMPERAVFRLRKWIIFRLVSIVDSLHLEMEEALTEQVARFCLFHSFFVTKKP    421 - 490
TSQIPETKHPFSFPLENQAREAVSSAFFSLLQTLSTQFKQAPGQTQGGQPWTYHLVQFADLLLNHSHNVT    491 - 560
TVTPFTAQQRQAWDRMLQTLKELEAHSAEARAAAFQHLLLLVGIHLLKSPAESCDLLGDIQTCIRKSLGE    561 - 630
KPRRSRTKTIDPQEPPWVEVLVEILLALLAQPSHLMRQVARSVFGHICSHLTPRALQLILDVLNPETSED    631 - 700
ENDRVVVTDDSDERRLKGAEDKSEEGEDNRSSESEEESEGEESEEEERDGDVDQGFREQLMTVLQAGKAL    701 - 770
GGEDSENEEELGDEAMMALDQSLASLFAEQKLRIQARRDEKNKLQKEKALRRDFQIRVLDLVEVLVTKQP    771 - 840
ENALVLELLEPLLSIIRRSLRSSSSKQEQDLLHKTARIFTHHLCRARRYCHDLGERAGALHAQVERLVQQ    841 - 910
AGRQPDSPTALYHFNASLYLLRVLKGNTAEGCVHETQEKQKAGTDPSHMPTGPQAASCLDLNLVTRVYST    911 - 980
ALSSFLTKRNSPLTVPMFLSLFSRHPVLCQSLLPILVQHITGPVRPRHQACLLLQKTLSMREVRSCFEDP    981 - 1050
EWKQLMGQVLAKVTENLRVLGEAQTKAQHQQALSSLELLNVLFRTCKHEKLTLDLTVLLGVLQGQQQSLQ   1051 - 1120
QGAHSTGSSRLHDLYWQAMKTLGVQRPKLEKKDAKEIPSATQSPISKKRKKKGFLPETKKRKKRKSEDGT   1121 - 1190
PAEDGTPAATGGSQPPSMGRKKRNRTKAKVPAQANGTPTTKSPAPGAPTRSPSTPAKSPKLQKKNQKPSQ   1191 - 1260
VNGAPGSPTEPAGQKQHQKALPKKGVLGKSPLSALARKKARLSLVIRSPSLLQSGAKKKAQVRKAGKP     1261 - 1328
//

Text Mined References (61)

PMID Year Title
26044764 2015 Gradual reduction in rRNA transcription triggers p53 acetylation and apoptosis via MYBBP1A.
25543088 2015 Regulation and function of Myb-binding protein 1A (MYBBP1A) in cellular senescence and pathogenesis of head and neck cancer.
25303791 2014 TPPII, MYBBP1A and CDK2 form a protein-protein interaction network.
24375404 2014 The nucleolar protein Myb-binding protein 1A (MYBBP1A) enhances p53 tetramerization and acetylation in response to nucleolar disruption.
24134843 2013 Inhibition of H3K18 deacetylation of Sirt7 by Myb-binding protein 1a (Mybbp1a).
23583237 2013 Nucleolar protein, Myb-binding protein 1A, specifically binds to nonacetylated p53 and efficiently promotes transcriptional activation.
23388179 2013 MYBBP1A suppresses breast cancer tumorigenesis by enhancing the p53 dependent anoikis.
23209159 2013 The switch from fetal to adult hemoglobin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23129390 2013 Identification of genetic associations of SP110/MYBBP1A/RELA with pulmonary tuberculosis in the Chinese Han population.
23056166 2012 Myb-binding protein 1A (MYBBP1A) is essential for early embryonic development, controls cell cycle and mitosis, and acts as a tumor suppressor.
22686419 2012 Epigeneitc silencing of ribosomal RNA genes by Mybbp1a.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22645127 2012 Myb-binding protein 1a (Mybbp1a) regulates levels and processing of pre-ribosomal RNA.
22339894 2012 Opposing function of MYBBP1A in proliferation and migration of head and neck squamous cell carcinoma cells.
21471221 2011 Novel nucleolar pathway connecting intracellular energy status with p53 activation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21297583 2011 RNA content in the nucleolus alters p53 acetylation via MYBBP1A.
21269460 2011 Initial characterization of the human central proteome.
20177074 2010 Identification of Myb-binding protein 1A (MYBBP1A) as a novel substrate for aurora B kinase.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19928837 2010 The SMN interactome includes Myb-binding protein 1a.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19276281 2009 Coassociation of estrogen receptor and p160 proteins predicts resistance to endocrine treatment; SRC-1 is an independent predictor of breast cancer recurrence.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18059336 2008 Ets-2 and p160 proteins collaborate to regulate c-Myc in endocrine resistant breast cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
17196614 2007 MYBBP1a is a novel repressor of NF-kappaB.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16603771 2006 The WSTF-SNF2h chromatin remodeling complex interacts with several nuclear proteins in transcription.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16413759 2006 Effects of exogenous p53 transfection on the gene expression in the human brain glioma cell line U251.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14744933 2004 Suppression of mitochondrial respiration through recruitment of p160 myb binding protein to PGC-1alpha: modulation by p38 MAPK.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
12171929 2002 A proteomics approach to identify proliferating cell nuclear antigen (PCNA)-binding proteins in human cell lysates. Identification of the human CHL12/RFCs2-5 complex as a novel PCNA-binding protein.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11779876 2002 The FXXLF motif mediates androgen receptor-specific interactions with coregulators.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10644447 1999 Molecular cloning and chromosomal mapping of the human homologue of MYB binding protein (P160) 1A (MYBBP1A) to 17p13.3.
9447996 1998 Molecular cloning reveals that the p160 Myb-binding protein is a novel, predominantly nucleolar protein which may play a role in transactivation by Myb.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8302594 1994 Detection of proteins that bind to the leucine zipper motif of c-Myb.