Property Summary

NCBI Gene PubMed Count 224
PubMed Score 925.47
PubTator Score 937.48

Knowledge Summary

Patent

No data available

Expression

 GO Component (2)

Protein-protein Interaction (2)

Gene RIF (161)

PMID Text
27032383 PIAS1 enhances p300 recruitment to c-Myb-bound sites through interaction with both proteins. In addition, the E3 activity of PIAS1 enhances further its coactivation
26829751 MYB-QKI rearrangements promote tumorigenesis through three mechanisms: MYB activation by truncation, enhancer translocation driving aberrant MYB-QKI expression and hemizygous loss of the tumor suppressor QKI
26829750 our study identifies super-enhancer translocations that drive MYB expression and provides insight into downstream MYB functions in alternate adenoid cystic carcinoma lineages.
26657649 MYB is aberrantly overexpressed in PC cells and acts as a key determinant of pancreatic tumour growth and metastasis
26462877 In summary, our results implicate that metastatic properties of some RMS subtypes might be linked to c-Myb function.
26208222 Our data suggest that c-Myb is a transcription factor with multifaceted target regulation depending on cell type.
26089205 Our results show that a subset of prostatic basal cell carcinoma s harbors rearrangement of MYB
26076064 Results indicate that cutaneous adenoid cystic carcinomas possess the same types of MYB alterations as ACCs of other anatomic sites.
25963073 Stage and margin status were important prognostic factors for ACC. Tumors with evidence of MYB-NFIB fusion were more likely to originate in minor salivary glands
25928412 conserved regulatory elements within the MYB core enhancer in individuals with sickle cell disease
25857824 In malignant spiradenocarcinoma, MYB expression was lost
25857263 The MYB/MAF co-silencing constrained the skewing of erythroid versus megakaryocyte lineage commitment in MYB-silenced CD34+ cells, by restraining the expansion of megakaryocyte lineage while partially rescuing the impairment of erythropoiesis.
25740244 Data show that Naphthol AS-E phosphate inhibits proto-oncogene protein Myb activity by disrupting its interaction with E1A binding protein p300.
25616133 c-MYB might target miR-143 in order to regulate stem cell properties, cell growth, apoptosis, and DNA damage repair.
25587024 Authors observed that forced MYB-NFIB expression in human salivary gland cells alters cell morphology and cell adhesion in vitro and depletion of VCAN blocked tumor cell growth of a short-term ACC tumor culture.
25530421 our observations suggest that miR-103a functioned as a tumour suppressor by targeting c-Myb. These findings indicate that miR-103a might play a significant role in pathogenesis of gastric cancer
25522282 miR-150 is an important suppressor of pancreatic ductal carcinoma and acts as a regulator of c-Myb and MUC4 in aggressive progress.
25488618 The study compares polymorphism at BCL11A to HBS1L-MYB loci and explains less of the variance in HbF in patients with sickle cell disease in Cameroon.
25457385 Genetic variant in the BCL11A (rs1427407), but not HBS1-MYB (rs6934903) loci associate with fetal hemoglobin levels in Indian sickle cell disease patients.
25394790 study found that heterozygous somatic mutations are acquired that introduce binding motifs for the MYB transcription factor in a precise noncoding site, which creates a super-enhancer upstream of the TAL1 oncogene; MYB binds to this new site
25231743 MicroRNA-193b-3p acts as a tumor suppressor by targeting the MYB oncogene in T-cell acute lymphoblastic leukemia.
25230975 High c-myb expression is associated with colorectal cancer.
25103188 results show that a p63(-) Myb(+) population of airway epithelial cells represents a distinct intermediate stage of differentiation
24847116 new mechanism-based therapeutic approaches for PCa by targeting PARP and the DDR pathway involving c-Myb, TopBP1, ataxia telangiectasia mutated- and Rad3-related (ATR), and Chk1.
24732452 Studied MYB oncogene in transformed adenoid cystic carcinomas.Data demonstrated that the MYB/NFIB translocation is not necessarily an early event or fundamental for the progression to adenoid cystic carcinoma with high-grade transformation.
24675898 miR-424 was involved in tumorigenesis of HCC at least in part by suppression of c-Myb.
24667352 Genetic variants of MYB is associated with sickle cell disease.
24614105 Several HBS1L-MYB intergenic variants reduce transcription factor binding, affecting interactions with MYB and MYB expression levels. This may explain the genetic association of HBS1L-MYB intergenic polymorphisms with erythroid traits and HbF levels.
24576033 Using FISH testing for detecting MYB gene abnormalities in the salivary gland of FNA biopsies has the potential to provide additional, helpful ancillary information in diagnosing adenoid cystic carcinomas
24504520 This study showed that the expression of miR34a negatively correlates with the expression of CDK4 and MYB and SIRT1 in pediatric patients with acute leukemia.
24486218 findings indicated that miR-195 functions as tumour suppressor in NSCLC, and the miR-195/MYB axis might represent a potential therapeutic target for NSCLC intervention
24302647 Myb gene over expression is useful for differential diagnosis of adenoid cystic carcinoma an pleomophic adenoma in salivary gland.
24283570 Direct repression of MYB by ZEB1 suppresses proliferation and epithelial gene expression during epithelial-to-mesenchymal transition of breast cancer cells.
24257756 of c-Myb, is detected preferentially in nonSUMOylated protein and has a negative effect on stress-induced SUMOylation of c-Myb. Stress-activated p38 MAPKs phosphorylate Thr(486) in c-Myb, attenuate its SUMOylation
24220303 reveals a complex network of proteins regulated by c-Myb.
24174222 the hypomethylation of the c-Myb motif upregulates the S100A4 expression in laryngeal cancer.
24121275 Data shows that MYB regulates the expression of endogenous human GFI1.
24067373 Activation of miR200 by c-Myb depends on ZEB1 expression and miR200 promoter methylation in breast cancer cells.
24013223 3'-LTR mutations may upregulate syncytin-1 expression, enabling it to participate in urothelial cell carcinoma tumorigenesis and development by interacting with c-Myb.
23980173 Characterize the structure of the transition state of the binding-induced folding in the reaction between the KIX domain of the CREB-binding protein and the transactivation domain of c-Myb.
23935942 NLK suppressed proliferation, induced apoptosis and mediated c-Myb degradation in MCF-7 cells.
23725736 Rearrangements of MYB were detected in 8 of 13 analyzed cases of adenoid cystic carcinoma of the lacrimal gland. Our data also suggest that MYB and its downstream targets are potential therapeutic targets for these tumors.
23658056 High c-myb expression is associated with esophageal squamous cell carcinoma.
23505388 These findings reveal an important and so far unknown connection between PRMT4 and the chromatin remodeller Mi2 in c-Myb signalling.
23483952 C-MYB can bind to the -709A allele of the MMP3 promoter, activate its transcription and lead to a higher expression of this gene.
23475628 High expression of c-myb is associated with lymph node metastasis and invasion in gallbladder adenocarcinoma.
23398943 ChIP assays showed that in U937 cells MYB binds to a conserved element upstream of the DRAK2 transcription start site.
23340802 Analysis of gene expression profiling arrays from acute myeloid leukemia patients uncovered significant correlations between FLT3 expression level and that of MYB and CEBPA.
22936743 Studies indicate that single nucleotide polymorphisms (SNPs) in regions of BCL11A and HBS1L-MYB intergenic polymorphism are the major modifiers of HbF in African Americans.
22910413 Fbxw5 enhances sumoylation of nuclear c-Myb.
22880131 These results unravel a critical role of c-Myb in promoting Erbin transcription in G2/M phase and also predict an unappreciated function of Erbin in cell cycle progression.
22853316 Transgenic K562 cells have distinct gene expression profiles both in steady state and during terminal erythroid differentiation, with GATA1s expression characterised by lack of repression of MYB, CCND2 and SKI.
22764095 c-Myb inhibition decreased cell proliferation, increased the number of cells in G(0) /G(1) phase of the cell cycle, increased the sensitivity of pre-B-ALL cells to cytotoxic agents, & delayed disease onset in a mouse model of leukemia.
22739149 In acute leukemic cells and leukemic bone marrow stromal cells, c-myc expression positively correlated with c-myb expression.
22714709 PUMA, c-Myb and p53 protein expression closely relates to the carcinogenesis, fast-progression, easy-metastasis, high-invasion, and poor-prognosis in gallbladder adenocarcinoma.
22516378 These studies show the mutual importance of c-Myb and the GR in controlling survival of pre-B acute lymphoblastic leukemia cells.
22505352 Explored copy number alterations rearrangements in adenoid cystic carcinoma. 86% of the tumors expressed MYB-NFIB fusion transcripts and 97% overexpressed MYB mRNA.
22439866 c-Myb regulates matrix metalloproteinases 1/9, and cathepsin D: implications for matrix-dependent breast cancer cell invasion and metastasis.
22431717 study provides first experimental evidence for a functional role of Myb in growth and malignant behavior of prostate cancer cells and suggest a novel mechanism for castration resistance
22391450 reveal a novel role for the MuvB complex in recruiting B-Myb and FoxM1 to promote late cell cycle gene expression and in regulating cell cycle gene expression from quiescence through mitosis.
22110127 TIP60 is a normal regulator of c-Myb function and that dysregulated or mutated TIP60 may contribute to c-Myb-driven leukemogenesis.
22101269 TGFbeta-induced c-Myb expression enhances invasion and aggressiveness of breast cancer cells.
22039304 c-Myb critically regulates IL-13 expression via direct binding to the conserved GATA-3 response element
22025269 MiR-150 interacts with the 3'UTR of c-Myb mRNA.
21976542 study concludes conclude that: t(6;9) results in complex genetic and molecular alterations in adenoid cystic carcinoma (ACC); MYB-NFIB gene fusion may not always be associated with chimeric transcript formation; noncanonical MYB-NFIB gene fusions occur in a subset of tumors; high MYB expression correlates with worse patient survival
21960247 a c-Myb-Bmi1 transcription-regulatory pathway is required for p190(BCR/ABL) leukemogenesis.
21953443 Breast cancer cells play a significant role in sustaining and amplifying the inflammation process through the activation of c-myb.
21901247 1 of the 9 Polymorphous low-grade adenocarcinomas (PLGA) expressed the adenoid cystic carcinoma-associated MYB-NFIB gene fusion; findings indicate that the PLGA genome is genetically stable
21853052 c-myb alternative RNA splicing was elevated and much more complex in leukemia samples.
21795403 GSK3beta inactivation induces apoptosis of leukemia cells by repressing the function of c-Myb
21618541 study demonstrates that benign sporadic, dermal cylindromas express the MYB-NFIB gene fusion
21590770 Micro Rna R-150 and its targeting of c-Myb may serve as a new mechanism underlying the colonic epithelial disruption in DSS-induced murine experimental colitis and in active human IBD.
21572406 our studies show that MYB activation through gene fusion or other mechanisms is a major oncogenic event in adenoid cystic carcinoma
21469677 A G-quadruplex structure formed in a c-myb repeat by a mechanism of transcription-coupled DNA repair that may represent a transcription roadblock in vivo.
21385855 A 3-bp deletion in the HBS1L-MYB intergenic region on chromosome 6q23 is associated with HbF expression.
21376705 These suggest that c-Myb play an important role in the hMSCs differentiation too, which is consistent with the epigenetic control mechanism of c-Myb.
21364958 Dramatic repositioning of c-Myb to different promoters during the cell cycle.
21338522 PIAS1 is a common partner for two cancer-related nuclear factors, c-Myb and FLASH.
21296997 Evidence of oncogenic activities of MYB in B-chronic lymphocytic leukemia that include its stimulatory role in MIR155HG transcription.
21261996 Results show that c-Myb associates with a surprisingly large number of promoters in human cells.
21205891 Data suggest that miR-15a, -16-1, and MYB may be important therapeutic targets to increase HbF levels in patients with sickle cell disease and beta-thalassemia.
21190594 c-Myb has a functionally important role in the regulation of OPN expression in hepatocellular carcinoma
21177182 The expression level of c-myb mRNA is closely related with the development of Barrett esophagus and esophageal adenocarcinoma.
21164292 MYB translocation and expression are useful diagnostic markers for a subset of adenoid cystic carcinomas, indicating local aggressive behavior.
21068433 Observational study of gene-disease association. (HuGE Navigator)
21046410 Increased expression of MYB may have a role in a subset of pediatric gliomas, through a variety of mechanisms in addition to MYB amplification and deletion.
20927387 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20816195 Observational study of gene-disease association. (HuGE Navigator)
20802522 SUMO binding was established as a mechanism involved in modulating the transactivation activity of c-Myb, and responsible for keeping the transforming potential of c-myb in check.
20702610 The findings suggest that MYB may be a specific novel target for tumor intervention in patients with salivary adenoid cystic carcinoma.
20686118 Overexpression of either KLF1 or LMO2 partially rescued the defect in erythropoiesis caused by c-myb silencing, whereas only KLF1 was also able to repress the megakaryocyte differentiation enhanced in Myb-silenced CD34+ cells.
20659323 Findings suggest MYB may be a viable therapeutic target in breast cancer.
20647765 This study, together with previous and recent data showing rearrangements and copy number alterations of the MYB locus in T-cell leukemia and certain solid tumors, will be the main focus of this review.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622260 Data show that the proto-oncogene c-Myb controls Slug transcription in tumor cells of different origin. Such a regulatory pathway contributes to the acquisition of invasive properties that are important for the metastatic process.
20547751 Hep27 is regulated at the transcriptional level by the proto-oncogene c-Myb and is required for c-Myb-induced p53 stabilization.
20531406 The human B-cell interactome (HBCI), reveals a hierarchical, transcriptional control module, where MYB and FOXM1 act as synergistic master regulators of proliferation in the germinal center (GC).
20524209 PMA induces overexpression of lysozyme via ERK1/2 MAP kinase-c-Myb signaling pathways
20484083 c-Myb, GATA-3, and Menin form a core transcription complex that regulates GATA-3 expression and, with the recruitment of MLL, results in Th2 cell maturation.
20472475 SNPs in BCL11A and the HBS1L-MYB region did not show statistically significant correlations with HbFlevels.This suggests that the BCL11A and HBS1L-MYB loci have a minor effect on HbF level compared to the XmnI QTL in beta-thalassemia intermedia patients.
20472475 Observational study of gene-disease association. (HuGE Navigator)
20364308 MyoD and c-myb are involved in regulation of basal and estrogen-induced transcription activity of the BRCA1 gene
20183929 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20142358 During differentiation, transgenic Myb-deficient CD4+CD8+ double-positive thymocytes undergo premature apoptosis due to decreased Bcl-xL expression; forced reintroduction of c-Myb restores Bcl-xL. expression.
20093773 c-Myb has the ability to transform hemtopoietic cells, which lends relevance to its role in mixed-lineage leukemia.
20027603 Enhanced expression of c-MYB is associated with ulcerative colitis-associated neoplasia.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19862010 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19860791 Observational study of gene-disease association. (HuGE Navigator)
19843942 c-Myb does not appear to be required for commitment to B cell differentiation but is crucial for B cell differentiation to the CD19-positive pro-B cell stage as well as survival of CD19-positive pro-B cells.
19841262 The MYB-NFIB fusion is a hallmark of adenoid cystic carcinomas (ACC) and deregulation of the expression of MYB and its target genes is a key oncogenic event in the pathogenesis of ACC.[MYB-NFIB fusion prtoein]
19737967 Results show that mutation of single residues in the c-MYB transactivation domain important for CBP/p300 binding leads to complete loss of transforming ability. Double mutants show severely impaired transact'n and are also defective for CBP/p300 binding.
19696200 Observational study of gene-disease association. (HuGE Navigator)
19646965 c-Myb appears to be phosphorylated by HIPK1 in its negative regulatory domain as supported by both in vivo and in vitro data.
19615744 The mRNA expression of transcription factor MYB, the designated target of miR-150, was shown to correlate inversely with the miR-150 level
19427836 These findings suggest that c-myb stimulates cell growth, in part, by regulating expression of the components of IGF-IGFBP axis in K562 cells.
19198610 SNPs at WDR36, IL33 and MYB that showed suggestive association with eosinophil counts were also associated with atopic asthma.
19198610 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19148297 Observational study of gene-disease association. (HuGE Navigator)
19036881 The results indicate that c-Myb potentiates Stat5a-driven gene expression, possibly functioning as a Stat5a coactivator, in human breast cancer.
18818702 a gain of the MYB locus, was found recurrently and only in the MYST3-linked AMLs (7/18 vs 0/34). MYST3-AMLs have also a specific a gene expression profile, which includes overexpression of MYB, CD4 and HOXA genes
18818396 these findings suggest the presence of a c-Myb-miR-15a autoregulatory feedback loop of potential importance in human hematopoiesis
18765672 Fbxw7, the F-box protein of an SCF complex, targets c-Myb for degradation in a Wnt-1- and NLK-dependent manner.
18708755 restoration of c-Myb levels partly alleviates tumors suppressive effects of miR-15a/16, suggesting that c-Myb is a key downstream target of this microRNA cluster
18667698 Observational study of gene-disease association. (HuGE Navigator)
18667440 c-Myb is an evolutionally conserved target of miR-150 and miR-150/c-Myb interaction is important for embryonic development and possibly oncogenesis
18498763 These data provide evidence that c-Myb may serve a previously unappreciated role in the coupling between transcription and splicing.
18476782 MYB is highly expressed in almost all estrogen-receptor-positive breast tumours & is a direct target of estrogen/ER signalling. It is required for tumor cell proliferation. Review.
18408764 c-Myb cooperates with FLASH in foci associated with active RNA polymerase II, leading to enhancement of Myb-dependent gene activation.
18195038 An array of variant transcripts, expressed in highly regulated, lineage-specific patterns were formed from alternate exons 8A, 9A, 9B, 10A, 13A, & 14A. They encoded c-Myb proteins with identical DNA binding domains but unique C-terminal domains.
18093978 TRAF6 is modified by small ubiquitin-related modifier-1, interacts with histone deacetylase 1, and represses c-Myb-mediated transactivation.
18070937 Alu--mediated MYB tandem duplication occurs at low frequency during normal thymocyte development and is clonally selected during the molecular pathogenesis of human T-ALL
17712044 The HBS1L-MYB intergenic region on chromosome 6q23.3 influences erythrocyte, platelet, and monocyte counts.
17690249 MYB is an effector of estrogen/estrogen signaling
17599807 Protein expression of c-Myb in human arterial vascular smooth muscle cells is stimulated by platelet-derived growth factor (PDGF).
17452517 The MYB(dup) alteration was associated with T-cell acute leukemia
17435759 Duplication of MYB is an oncogenic event and we suggest that MYB could be a therapeutic target in human T cell acute lymphoblastic leukemia.
17363689 c-Myb regulates cell cycle-associated IP3R1 transcription in VSMCs via specific highly conserved Myb-binding sites in the IP3R1 promoter.
17242210 c-Myb protein plays a previously unappreciated role in the G(2)/M cell cycle transition of normal and malignant human hematopoietic cells
17095623 a lack of integrin engagement leads to the induction of cellular markers associated with myeloid differentiation
16977606 Among MYB regulation, the most dynamic is the control of transcriptional elongation by sequences within intron 1, this regulatory sequence is transcribed into an RNA stem-loop and 19-residue polyuridine tract, and is subject to mutation in colon cancer.
16861354 individuals with elevated HbF levels during adult erythropoiesis demonstrated simultaneous transcriptional down-regulation in cMYB and HBS1L
16797705 The enhanced stability of c-Myb in CML blast crisis cells and perhaps in other types of leukemia is not caused by a genetic mechanism.
16631597 Together, these results show that the cAMP pathway blocks gamma-globin gene expression in K562 cells by increasing c-Myb expression.
16597594 c-Myb is a major factor that controls differentiation as well as proliferation of hematopoietic progenitor cells derived from hemogenic endothelial cells; appropriate levels of c-Myb protein are strictly defined at distinct differentiation steps
16461764 point mutation are uncommon in patients with myeloproliferative disorders
16299810 EGF-induced activation of B-Myb promoter required both E2F and EGFR target sites
15927960 c-Myb has a longer half-life (at least 2-fold) in BCR/ABL-expressing than in normal hematopoietic cells
15778089 data suggest that amplification of c-myb in tumor cells may lead to robust GRP78 gene induction, which may in turn assist cells in survival under conditions of oxygen deprivation and nutrient stress
15747776 10 genes were down-regulated following treatment of the T-ALL cells with 0.15 and 1.5 microg/mL of metal ores at 72 h.
15687240 c-Myb activity is directly regulated by cyclin D1 and CDKs and imply that c-Myb activity is regulated during the cell cycle in hematopoietic cells
15509555 p53 antagonizes c-Myb by recruiting mSin3A to down-regulate specific Myb target genes
15221349 Observational study of gene-disease association. (HuGE Navigator)
15187020 NmU expression is related to Myb and that the NmU/NMU1R axis constitutes a previously unknown growth-promoting autocrine loop in myeloid leukemia cells
12631292 Data suggest that the negative influence on transactivation properties by the negative regulatory domain region of c-Myb depends on sumoylation sites.
12529244 involvement of c-myb in the regulation of intestinal nutrient absorption
12424255 role in regulating type I collagen alpha 2 chain gene
12370369 c-Myb has no apparent effect on core binding factor/polyoma enhancer-binding protein 2 binding, but is critical for activation of enhancer-dependent transcription of the TCR delta enhancer.
11973331 c-Myb transactivates the IGFBP-5 promoter
11896618 Friend murine erythroleukemia cells are held in an immature and proliferating state by a pathway that is dependent on Myb activity
11848471 Activation of c-MYC and c-MYB proto-oncogenes is associated with decreased apoptosis in tumor colon progression.

AA Sequence

MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYL      1 - 70
PNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNP     71 - 140
EVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQESSKASQPAV    141 - 210
ATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAI    211 - 280
QRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGE    281 - 350
HHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLT    351 - 420
STPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQT    421 - 490
PSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNFFCSHHWEGDSLNTQLFTQTS    491 - 560
PVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYV    561 - 630
NAFSARTLVM                                                                631 - 640
//

Text Mined References (227)

PMID Year Title
27032383 2016 PIAS1 binds p300 and behaves as a coactivator or corepressor of the transcription factor c-Myb dependent on SUMO-status.
26829751 2016 MYB-QKI rearrangements in angiocentric glioma drive tumorigenicity through a tripartite mechanism.
26829750 2016 An oncogenic MYB feedback loop drives alternate cell fates in adenoid cystic carcinoma.
26657649 2015 MYB is a novel regulator of pancreatic tumour growth and metastasis.
26462877 2015 The Expression of c-Myb Correlates with the Levels of Rhabdomyosarcoma-specific Marker Myogenin.
26208222 2015 c-Myb Binding Sites in Haematopoietic Chromatin Landscapes.
26089205 2015 A subset of prostatic basal cell carcinomas harbor the MYB rearrangement of adenoid cystic carcinoma.
26076064 2015 Detection of MYB Alterations and Other Immunohistochemical Markers in Primary Cutaneous Adenoid Cystic Carcinoma.
25963073 2015 MYB rearrangement and clinicopathologic characteristics in head and neck adenoid cystic carcinoma.
25928412 2015 Genetic association of fetal-hemoglobin levels in individuals with sickle cell disease in Tanzania maps to conserved regulatory elements within the MYB core enhancer.
25857824 2015 Morphologically low-grade spiradenocarcinoma: a clinicopathologic study of 19 cases with emphasis on outcome and MYB expression.
25857263 2015 MYB controls erythroid versus megakaryocyte lineage fate decision through the miR-486-3p-mediated downregulation of MAF.
25740244 2015 Naphthol AS-E Phosphate Inhibits the Activity of the Transcription Factor Myb by Blocking the Interaction with the KIX Domain of the Coactivator p300.
25616133 2015 c-MYB regulates cell growth and DNA damage repair through modulating MiR-143.
25587024 2014 A unifying gene signature for adenoid cystic cancer identifies parallel MYB-dependent and MYB-independent therapeutic targets.
25530421 2015 MicroRNA-103a inhibits gastric cancer cell proliferation, migration and invasion by targeting c-Myb.
25522282 2015 A decrease in miR-150 regulates the malignancy of pancreatic cancer by targeting c-Myb and MUC4.
25488618 2015 Polymorphism at BCL11A compared to HBS1L-MYB loci explains less of the variance in HbF in patients with sickle cell disease in Cameroon.
25457385 2015 Genetic variant in the BCL11A (rs1427407), but not HBS1-MYB (rs6934903) loci associate with fetal hemoglobin levels in Indian sickle cell disease patients.
25394790 2014 Oncogene regulation. An oncogenic super-enhancer formed through somatic mutation of a noncoding intergenic element.
25372704 2014 Genome wide association study of fetal hemoglobin in sickle cell anemia in Tanzania.
25231743 2015 MicroRNA-193b-3p acts as a tumor suppressor by targeting the MYB oncogene in T-cell acute lymphoblastic leukemia.
25230975 2014 miR-150 functions as a tumour suppressor in human colorectal cancer by targeting c-Myb.
25103188 2014 Myb permits multilineage airway epithelial cell differentiation.
24847116 2014 Targeting poly(ADP-ribose) polymerase and the c-Myb-regulated DNA damage response pathway in castration-resistant prostate cancer.
24732452 2014 Analysis of MYB oncogene in transformed adenoid cystic carcinomas reveals distinct pathways of tumor progression.
24675898 2014 MicroRNA-424 is down-regulated in hepatocellular carcinoma and suppresses cell migration and invasion through c-Myb.
24667352 2014 Association of variants at BCL11A and HBS1L-MYB with hemoglobin F and hospitalization rates among sickle cell patients in Cameroon.
24647736 2014 Multiple nonglycemic genomic loci are newly associated with blood level of glycated hemoglobin in East Asians.
24614105 2014 HBS1L-MYB intergenic variants modulate fetal hemoglobin via long-range MYB enhancers.
24576033 2014 MYB gene abnormalities t(6;9) in adenoid cystic carcinoma fine-needle aspiration biopsy using fluorescence in situ hybridization.
24504520 2014 A correlation analysis of miRNA?34a and its predicted target genes in leukemia.
24486218 2014 MicroRNA-195 inhibits non-small cell lung cancer cell proliferation, migration and invasion by targeting MYB.
24302647 2014 MYB immunostaining is a useful ancillary test for distinguishing adenoid cystic carcinoma from pleomorphic adenoma in fine-needle aspiration biopsy specimens.
24283570 2013 Direct repression of MYB by ZEB1 suppresses proliferation and epithelial gene expression during epithelial-to-mesenchymal transition of breast cancer cells.
24257756 2013 Stress-induced phosphorylation of Thr486 in c-Myb by p38 mitogen-activated protein kinases attenuates conjugation of SUMO-2/3.
24220303 2014 Proteome changes induced by c-myb silencing in human chronic myeloid leukemia cells suggest molecular mechanisms and putative biomarkers of hematopoietic malignancies.
24174222 2014 S100A4 is upregulated via the binding of c-Myb in methylation-free laryngeal cancer cells.
24149102 2013 Variation at 3p24.1 and 6q23.3 influences the risk of Hodgkin's lymphoma.
24121275 2014 The MYB proto-oncogene suppresses monocytic differentiation of acute myeloid leukemia cells via transcriptional activation of its target gene GFI1.
24067373 2013 Activation of miR200 by c-Myb depends on ZEB1 expression and miR200 promoter methylation.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
24013223 2014 Mutations in 3'-long terminal repeat of HERV-W family in chromosome 7 upregulate syncytin-1 expression in urothelial cell carcinoma of the bladder through interacting with c-Myb.
23980173 2013 Structure of the transition state for the binding of c-Myb and KIX highlights an unexpected order for a disordered system.
23935956 2013 Genome wide association analysis of a founder population identified TAF3 as a gene for MCHC in humans.
23935942 2013 Nemo-like kinase associated with proliferation and apoptosis by c-Myb degradation in breast cancer.
23725736 2013 Adenoid cystic carcinoma of the lacrimal gland: MYB gene activation, genomic imbalances, and clinical characteristics.
23658056 2013 Expression and prognostic role of c-Myb as a novel cell cycle protein in esophageal squamous cell carcinoma.
23505388 2013 PRMT4 is a novel coactivator of c-Myb-dependent transcription in haematopoietic cell lines.
23483952 2013 Allelic variation of the MMP3 promoter affects transcription activity through the transcription factor C-MYB in human brain arteriovenous malformations.
23475628 2013 Expression of p53 upregulated modulator of apoptosis (PUMA) and C-myb in gallbladder adenocarcinoma and their pathological significance.
23398943 2013 The MYB oncogene can suppress apoptosis in acute myeloid leukemia cells by transcriptional repression of DRAK2 expression.
23340802 2013 C/EBP? and MYB regulate FLT3 expression in AML.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23166356 2012 BCL6 positively regulates AID and germinal center gene expression via repression of miR-155.
23043469 2013 HbA2 levels in normal adults are influenced by two distinct genetic mechanisms.
22936743 2012 Meta-analysis of 2040 sickle cell anemia patients: BCL11A and HBS1L-MYB are the major modifiers of HbF in African Americans.
22910413 2012 Fbxw5 suppresses nuclear c-Myb activity via DDB1-Cul4-Rbx1 ligase-mediated sumoylation.
22880131 2012 c-Myb regulates cell cycle-dependent expression of Erbin: an implication for a novel function of Erbin.
22853316 2012 The GATA1s isoform is normally down-regulated during terminal haematopoietic differentiation and over-expression leads to failure to repress MYB, CCND2 and SKI during erythroid differentiation of K562 cells.
22764095 2012 Role of c-Myb in the survival of pre B-cell acute lymphoblastic leukemia and leukemogenesis.
22739149 2012 [Expression of c-myc and c-myb gene in leukemic bone marrow stromal cells and their correlation].
22714709 2013 Immunohistochemical study of PUMA, c-Myb and p53 expression in the benign and malignant lesions of gallbladder and their clinicopathological significances.
22516378 2012 c-Myb interacts with the glucocorticoid receptor and regulates its level in pre-B-acute lymphoblastic leukemia cells.
22505352 2012 Clinically significant copy number alterations and complex rearrangements of MYB and NFIB in head and neck adenoid cystic carcinoma.
22439866 2012 c-Myb regulates matrix metalloproteinases 1/9, and cathepsin D: implications for matrix-dependent breast cancer cell invasion and metastasis.
22431717 2012 Myb overexpression overrides androgen depletion-induced cell cycle arrest and apoptosis in prostate cancer cells, and confers aggressive malignant traits: potential role in castration resistance.
22423221 2012 A meta-analysis and genome-wide association study of platelet count and mean platelet volume in african americans.
22391450 2012 The MuvB complex sequentially recruits B-Myb and FoxM1 to promote mitotic gene expression.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22110127 2012 The histone acetyltransferase TIP60 interacts with c-Myb and inactivates its transcriptional activity in human leukemia.
22101269 2011 TGF?-induced c-Myb affects the expression of EMT-associated genes and promotes invasion of ER+ breast cancer cells.
22039304 2011 c-Myb and GATA-3 cooperatively regulate IL-13 expression via conserved GATA-3 response element and recruit mixed lineage leukemia (MLL) for histone modification of the IL-13 locus.
22025269 2012 microRNA-150 inhibits human CD133-positive liver cancer stem cells through negative regulation of the transcription factor c-Myb.
21976542 2011 Novel chromosomal rearrangements and break points at the t(6;9) in salivary adenoid cystic carcinoma: association with MYB-NFIB chimeric fusion, MYB expression, and clinical outcome.
21960247 2012 c-Myb and its target Bmi1 are required for p190BCR/ABL leukemogenesis in mouse and human cells.
21953443 2011 c-myb mediates inflammatory reaction against oxidative stress in human breast cancer cell line, MCF-7.
21901247 2012 Studies of genomic imbalances and the MYB-NFIB gene fusion in polymorphous low-grade adenocarcinoma of the head and neck.
21853052 2011 Single molecule analysis of c-myb alternative splicing reveals novel classifiers for precursor B-ALL.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21795403 2011 GSK3? inactivation induces apoptosis of leukemia cells by repressing the function of c-Myb.
21738478 2011 Identification of nine novel loci associated with white blood cell subtypes in a Japanese population.
21618541 2011 The MYB-NFIB gene fusion-a novel genetic link between adenoid cystic carcinoma and dermal cylindroma.
21590770 2011 Role of miR-150-targeting c-Myb in colonic epithelial disruption during dextran sulphate sodium-induced murine experimental colitis and human ulcerative colitis.
21572406 2011 Analysis of MYB expression and MYB-NFIB gene fusions in adenoid cystic carcinoma and other salivary neoplasms.
21469677 2011 Transcription arrest by a G quadruplex forming-trinucleotide repeat sequence from the human c-myb gene.
21385855 2011 A 3-bp deletion in the HBS1L-MYB intergenic region on chromosome 6q23 is associated with HbF expression.
21376705 2011 Overexpression of the c-Myb but not its leukemogenic mutant DNA-binding domain increased adipogenic differentiation in mesenchymal stem cells.
21364958 2011 Dramatic repositioning of c-Myb to different promoters during the cell cycle observed by combining cell sorting with chromatin immunoprecipitation.
21338522 2011 PIAS1 interacts with FLASH and enhances its co-activation of c-Myb.
21296997 2011 MYB transcriptionally regulates the miR-155 host gene in chronic lymphocytic leukemia.
21261996 2011 Identification and regulation of c-Myb target genes in MCF-7 cells.
21205891 2011 MicroRNA-15a and -16-1 act via MYB to elevate fetal hemoglobin expression in human trisomy 13.
21190594 2010 Transcription factor c-Myb promotes the invasion of hepatocellular carcinoma cells via increasing osteopontin expression.
21177182 2010 [Expression of c-myb in reflux esophagitis, Barrett esophagus and esophageal adenocarcinoma].
21164292 2011 MYB expression and translocation in adenoid cystic carcinomas and other salivary gland tumors with clinicopathologic correlation.
21068433 2011 Genetics of fetal hemoglobin in Tanzanian and British patients with sickle cell anemia.
21046410 2010 MYB upregulation and genetic aberrations in a subset of pediatric low-grade gliomas.
20927387 2010 A genome-wide association study of red blood cell traits using the electronic medical record.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20802522 2011 A functional SUMO-interacting motif in the transactivation domain of c-Myb regulates its myeloid transforming ability.
20702610 2010 Comprehensive analysis of the MYB-NFIB gene fusion in salivary adenoid cystic carcinoma: Incidence, variability, and clinicopathologic significance.
20686118 2010 c-myb supports erythropoiesis through the transactivation of KLF1 and LMO2 expression.
20659323 2010 MYB suppresses differentiation and apoptosis of human breast cancer cells.
20647765 2010 New tricks from an old oncogene: gene fusion and copy number alterations of MYB in human cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20622260 2010 Expression of Slug is regulated by c-Myb and is required for invasion and bone marrow homing of cancer cells of different origin.
20547751 2010 Mitochondrial Hep27 is a c-Myb target gene that inhibits Mdm2 and stabilizes p53.
20531406 2010 A human B-cell interactome identifies MYB and FOXM1 as master regulators of proliferation in germinal centers.
20524209 2010 Activation of c-Myb transcription factor is critical for PMA-induced lysozyme expression in airway epithelial cells.
20484083 2010 c-Myb, Menin, GATA-3, and MLL form a dynamic transcription complex that plays a pivotal role in human T helper type 2 cell development.
20472475 2010 The XmnI (G)gamma polymorphism influences hemoglobin F synthesis contrary to BCL11A and HBS1L-MYB SNPs in a cohort of 57 beta-thalassemia intermedia patients.
20364308 2011 Involvement of MyoD and c-myb in regulation of basal and estrogen-induced transcription activity of the BRCA1 gene.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20183929 2010 A genome-wide association identified the common genetic variants influence disease severity in beta0-thalassemia/hemoglobin E.
20142358 2010 c-Myb promotes the survival of CD4+CD8+ double-positive thymocytes through upregulation of Bcl-xL.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20093773 2010 c-Myb binds MLL through menin in human leukemia cells and is an important driver of MLL-associated leukemogenesis.
20027603 2010 Enhanced expression of proproliferative and antiapoptotic genes in ulcerative colitis-associated neoplasia.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
19860791 2010 Genetic evidence for a role of IL33 in nasal polyposis.
19853236 2009 Sequence variants in three loci influence monocyte counts and erythrocyte volume.
19843942 2009 c-Myb is required for pro-B cell differentiation.
19841262 2009 Recurrent fusion of MYB and NFIB transcription factor genes in carcinomas of the breast and head and neck.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
19737967 2009 Mutations in multiple domains of c-Myb disrupt interaction with CBP/p300 and abrogate myeloid transforming ability.
19696200 2009 Amelioration of Sardinian beta0 thalassemia by genetic modifiers.
19646965 2009 HIPK1 interacts with c-Myb and modulates its activity through phosphorylation.
19615744 2010 Significant inverse correlation of microRNA-150/MYB and microRNA-222/p27 in myelodysplastic syndrome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19427836 2009 c-myb stimulates cell growth by regulation of insulin-like growth factor (IGF) and IGF-binding protein-3 in K562 leukemia cells.
19198610 2009 Sequence variants affecting eosinophil numbers associate with asthma and myocardial infarction.
19148297 2009 Genetic variation on chromosome 6 influences F cell levels in healthy individuals of African descent and HbF levels in sickle cell patients.
19036881 2009 Role of c-Myb during prolactin-induced signal transducer and activator of transcription 5a signaling in breast cancer cells.
18818702 2009 Genome profiling of acute myelomonocytic leukemia: alteration of the MYB locus in MYST3-linked cases.
18818396 2009 The c-myb proto-oncogene and microRNA-15a comprise an active autoregulatory feedback loop in human hematopoietic cells.
18765672 2008 Fbxw7 acts as an E3 ubiquitin ligase that targets c-Myb for nemo-like kinase (NLK)-induced degradation.
18708755 2008 c-Myb oncoprotein is an essential target of the dleu2 tumor suppressor microRNA cluster.
18667698 2008 DNA polymorphisms at the BCL11A, HBS1L-MYB, and beta-globin loci associate with fetal hemoglobin levels and pain crises in sickle cell disease.
18667440 2008 c-Myb is an evolutionary conserved miR-150 target and miR-150/c-Myb interaction is important for embryonic development.
18548008 2008 A B-Myb complex containing clathrin and filamin is required for mitotic spindle function.
18498763 2008 The transcription factor c-Myb affects pre-mRNA splicing.
18476782 2008 Estrogen and MYB in breast cancer: potential for new therapies.
18408764 2008 FLASH acts as a co-activator of the transcription factor c-Myb and localizes to active RNA polymerase II foci.
18195038 2008 Alternative RNA splicing produces multiple forms of c-Myb with unique transcriptional activities.
18093978 2008 Nuclear tumor necrosis factor receptor-associated factor 6 in lymphoid cells negatively regulates c-Myb-mediated transactivation through small ubiquitin-related modifier-1 modification.
18070937 2007 Alu elements mediate MYB gene tandem duplication in human T-ALL.
17923094 2007 MiR-150 controls B cell differentiation by targeting the transcription factor c-Myb.
17712044 2007 The HBS1L-MYB intergenic region on chromosome 6q23.3 influences erythrocyte, platelet, and monocyte counts in humans.
17690249 2007 Mechanism of and requirement for estrogen-regulated MYB expression in estrogen-receptor-positive breast cancer cells.
17599807 2007 The c-Myb functions as a downstream target of PDGF-mediated survival signal in vascular smooth muscle cells.
17452517 2007 The C-MYB locus is involved in chromosomal translocation and genomic duplications in human T-cell acute leukemia (T-ALL), the translocation defining a new T-ALL subtype in very young children.
17435759 2007 Duplication of the MYB oncogene in T cell acute lymphoblastic leukemia.
17363689 2007 c-Myb-dependent inositol 1,4,5-trisphosphate receptor type-1 expression in vascular smooth muscle cells.
17242210 2007 c-Myb contributes to G2/M cell cycle transition in human hematopoietic cells by direct regulation of cyclin B1 expression.
17095623 2007 Cytokine and integrin stimulation synergize to promote higher levels of GATA-2, c-myb, and CD34 protein in primary human hematopoietic progenitors from bone marrow.
16977606 2006 Mutations in the MYB intron I regulatory sequence increase transcription in colon cancers.
16861354 2006 cMYB is involved in the regulation of fetal hemoglobin production in adults.
16799563 2006 An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis.
16797705 2007 Coding sequence and intron-exon junctions of the c-myb gene are intact in the chronic phase and blast crisis stages of chronic myeloid leukemia patients.
16631597 2006 cAMP differentially regulates gamma-globin gene expression in erythroleukemic cells and primary erythroblasts through c-Myb expression.
16597594 2006 Proper levels of c-Myb are discretely defined at distinct steps of hematopoietic cell development.
16461764 2006 More on Myb in myelofibrosis: molecular analyses of MYB and EP300 in 55 patients with myeloproliferative disorders.
16299810 2006 Co-regulation of B-Myb expression by E2F1 and EGF receptor.
15927960 2005 Enhanced proliferative potential of hematopoietic cells expressing degradation-resistant c-Myb mutants.
15778089 2005 Expression of stress response protein glucose regulated protein-78 mediated by c-Myb.
15747776 2003 Dose-dependent transcriptome changes by metal ores on a human acute lymphoblastic leukemia cell line.
15691758 2005 c-Myb and p300 regulate hematopoietic stem cell proliferation and differentiation.
15687240 2005 Positive and negative regulation of c-Myb by cyclin D1, cyclin-dependent kinases, and p27 Kip1.
15509555 2004 p53 suppresses c-Myb-induced trans-activation and transformation by recruiting the corepressor mSin3A.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15221349 2004 The intron 6 G/T polymorphism of c-myb oncogene and the risk for coronary in-stent restenosis.
15187020 2004 Neuromedin U: a Myb-regulated autocrine growth factor for human myeloid leukemias.
15169551 2004 Genome annotation of a 1.5 Mb region of human chromosome 6q23 encompassing a quantitative trait locus for fetal hemoglobin expression in adults.
15082531 2004 Wnt-1 signal induces phosphorylation and degradation of c-Myb protein via TAK1, HIPK2, and NLK.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12631292 2003 Transactivation properties of c-Myb are critically dependent on two SUMO-1 acceptor sites that are conjugated in a PIASy enhanced manner.
12529244 2003 Transcriptional regulation of the human NaPi-IIb cotransporter by EGF in Caco-2 cells involves c-myb.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12424255 2003 Characterization of the c-Myb-responsive region and regulation of the human type I collagen alpha 2 chain gene by c-Myb.
12370369 2002 Distinct roles for c-Myb and core binding factor/polyoma enhancer-binding protein 2 in the assembly and function of a multiprotein complex on the TCR delta enhancer in vivo.
12196545 2002 Roles of phosphorylation and helix propensity in the binding of the KIX domain of CREB-binding protein by constitutive (c-Myb) and inducible (CREB) activators.
11973331 2002 Expression of insulin-like growth factor-binding protein 5 in neuroblastoma cells is regulated at the transcriptional level by c-Myb and B-Myb via direct and indirect mechanisms.
11848471 Activation of c-MYC and c-MYB proto-oncogenes is associated with decreased apoptosis in tumor colon progression.
11792321 2002 Mechanism of c-Myb-C/EBP beta cooperation from separated sites on a promoter.
11781241 2002 Cooperative binding of c-Myb and Pax-5 activates the RAG-2 promoter in immature B cells.
11779867 2002 Covalent attachment of the SUMO-1 protein to the negative regulatory domain of the c-Myb transcription factor modifies its stability and transactivation capacity.
11313925 2001 Constitutive c-Myb amino-terminal phosphorylation and DNA binding activity uncoupled during entry and passage through the cell cycle.
10747903 2000 p53 suppresses the c-Myb-induced activation of heat shock transcription factor 3.
10656693 2000 c-Myb acetylation at the carboxyl-terminal conserved domain by transcriptional co-activator p300.
10378697 1999 The myb gene family in cell growth, differentiation and apoptosis.
10318867 1999 Myb-interacting protein, ATBF1, represses transcriptional activity of Myb oncoprotein.
10233885 1999 C/EBPepsilon directly interacts with the DNA binding domain of c-myb and cooperatively activates transcription of myeloid promoters.
9823328 1998 c-Myb down-regulation is associated with human colon cell differentiation, apoptosis, and decreased Bcl-2 expression.
9809063 1998 Pim-1 kinase and p100 cooperate to enhance c-Myb activity.
9566892 1998 c-Maf interacts with c-Myb to regulate transcription of an early myeloid gene during differentiation.
9447996 1998 Molecular cloning reveals that the p160 Myb-binding protein is a novel, predominantly nucleolar protein which may play a role in transactivation by Myb.
8960373 1996 Functional analysis of phosphorylation at serine 532 of human c-Myb by MAP kinase.
8756344 1996 The EVES motif mediates both intermolecular and intramolecular regulation of c-Myb.
8329139 1993 Stress-associated modulation of proto-oncogene expression in human peripheral blood leukocytes.
8302594 1994 Detection of proteins that bind to the leucine zipper motif of c-Myb.
8302584 1994 Identification of a second promoter in the human c-myb proto-oncogene.
7987850 1994 DNA binding and transactivation activity of A-myb, a c-myb-related gene.
7784067 1995 High affinity DNA binding of native full length c-Myb and differential proteolytic sensitivity of its N- and C-terminal domains.
7688794 1993 Regulation of proliferation and cytokine expression of bone marrow fibroblasts: role of c-myb.
7584027 1994 An expression profile of active genes in human colonic mucosa.
6954533 1982 Differential expression of the amv gene in human hematopoietic cells.
6866112 1983 Chromosomal sublocalization of human c-myb and c-fes cellular onc genes.
6850556 1983 Chromosome 6 in malignant melanoma.
6672765 1983 Regional chromosomal localization of N-ras, K-ras-1, K-ras-2 and myb oncogenes in human cells.
6585957 1984 Amplification of the c-myb oncogene in a case of human acute myelogenous leukemia.
6324165 1983 Structural organization and expression of human DNA sequences related to the transforming gene of avian myeloblastosis virus.
6289315 1982 Chromosomal assignment of the human homologues of feline sarcoma virus and avian myeloblastosis virus onc genes.
3941898 1986 Alterations of myc, myb, and rasHa proto-oncogenes in cancers are frequent and show clinical correlation.
3540945 1986 Human c-myb protooncogene: nucleotide sequence of cDNA and organization of the genomic locus.
3469751 1987 Relationship between the c-myb locus and the 6q-chromosomal aberration in leukemias and lymphomas.
3014652 1986 Studies of the human c-myb gene and its product in human acute leukemias.
3007038 1986 Sublocalization of c-myb to 6q21----q23 by in situ hybridization and c-myb expression in a human teratocarcinoma with 6q rearrangements.
2829178 1988 Structural alteration in the MYB protooncogene and deletion within the gene encoding alpha-type protein kinase C in human melanoma cell lines.
2687764 1989 Identification of alternatively spliced transcripts for human c-myb: molecular cloning and sequence analysis of human c-myb exon 9A sequences.
2487149 1989 Molecular mapping of the oncogene MYB and rearrangements in malignant melanoma.
2202948 1990 Alternative splicing of the human c-myb gene.
2189102 1990 Transcriptional activation by human c-myb and v-myb genes.
1944282 1991 Positive autoregulation of c-myb expression via Myb binding sites in the 5' flanking region of the human c-myb gene.