Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.45
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -1.200 2.3e-02
ependymoma -1.200 1.0e-02
oligodendroglioma -1.100 7.5e-03
psoriasis -1.100 1.5e-05
osteosarcoma 1.232 1.0e-02
atypical teratoid/rhabdoid tumor -1.200 2.3e-06
Duchenne muscular dystrophy 1.164 2.2e-09
Atopic dermatitis -1.100 3.4e-04
primary pancreatic ductal adenocarcinoma 1.296 1.7e-02
tuberculosis -1.300 3.7e-04
intraductal papillary-mucinous adenoma (... -2.300 5.7e-04
intraductal papillary-mucinous carcinoma... -1.600 1.1e-02
intraductal papillary-mucinous neoplasm ... -2.400 5.8e-03
active Crohn's disease 2.119 7.0e-03
breast carcinoma -1.300 1.1e-04
fibroadenoma -1.200 3.7e-03
non primary Sjogren syndrome sicca 1.100 3.7e-02
ductal carcinoma in situ -1.300 1.3e-03
invasive ductal carcinoma -1.600 9.6e-03
ulcerative colitis 1.400 4.1e-03
ovarian cancer -1.800 8.0e-05
pancreatic cancer 1.100 1.3e-02

Synonym

Accession P84157 Q0P5W3
Symbols TMAP1
PS1TP1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MEAPAELLAALPALATALALLLAWLLVRRGAAASPEPARAPPEPAPPAEATGAPAPSRPCAPEPAASPAG      1 - 70
PEEPGEPAGLGELGEPAGPGEPEGPGDPAAAPAEAEEQAVEARQEEEQDLDGEKGPSSEGPEEEDGEGFS     71 - 140
FKYSPGKLRGNQYKKMMTKEELEEEQRVQKEQLAAIFKLMKDNKETFGEMSDGDVQEQLRLYDM          141 - 204
//

Text Mined References (9)

PMID Year Title
23776548 2013 Genetic loci for retinal arteriolar microcirculation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.